The URL can be used to link to this page

Home My WebLink About2011 04-25 City Council/Manger Workshop Packet AGENDA MAPLEWOOD CITY COUNCIL MANAGER WORKSHOP 5:15P.M. Monday,April 25, 2011 Council Chambers, City Hall A.CALL TO ORDER B.ROLL CALL C.APPROVAL OF AGENDA D.UNFINISHED BUSINESS 1.Commission/Board Interviews a.Business & Economic Development Commission E.NEW BUSINESS 1.Discussion on Emerald Ash Borer Plan 2.Capital Improvement Plan – Review of Draft Report F.ADJOURNMENT THIS PAGE IS INTENTIONALLY LEFT BLANK Work Session Agenda Item D1 AGENDA REPORT TO : James Antonen, City Manager FROM: Charles Ahl, Assistant City Manager Sarah Burlingame, Senior Administrative Assistant SUBJECT: Commission/Board Applicant Interviews a.Business & Economic Development Commission DATE:April 20, 2011 INTRODUCTION The City Council will be conducting interviews of candidates for the Business & Economic Development Commission. One (1) isseat open on the Business & Economic Development Commission which was created by aresignation, thereforethe individual appointed to this commission would serve the remainder of that termwhich expires September 30, 2013. This is a continuation of interviews from April 4, 2010 workshop as this candidate was unable to attend the first interview. RECOMMENDATION Staff recommends that the Council interview the candidate as indicated in the schedule below. The questions will be submitted to the Council under separate cover.During the interview process, Council Members should fill out their ballots. Once the Interview hasconcluded, Council Members should submit their ballots to staff, which will be tallied with the results brought back to the Council regular meeting following this workshop with recommendations for appointments. The schedule is as follows: Business Economic Development Commission (1 opening) 5:15 PM Jennifer Lewis Attachments: 1.Candidate Applications PacketPageNumber3of194 PacketPageNumber4of194 Agenda Item E1 MEMORANDUM TO: James Antonen, City Manager FROM: DuWayne Konewko, Director Parks and Recreation Ginny Gaynor, Natural Resources Coordinator SUBJECT: Discussion on Emerald Ash Borer Plan DATE: April 19, 2011 for April 25, 2011 Council Workshop INTRODUCTION In Spring 2009, Emerald Ash Borer (EAB) was discovered in St. Paul, Minnesota. Communities throughout Minnesota are developing plans to manage this pest. Maplewood’s City Forester is working with staff and commissions to develop an EAB plan for the city. In March 2011, a draft plan was reviewed by the Parks Commission and the Environmental and Natural Resources th Commission. At the April 25 council workshop, council members will review and discuss the proposed EAB plan. DISCUSSION Emerald ash borer is a non-native beetle that causes widespread decline and death of ash trees. The larval stage of EAB feeds on the tissue between the bark and the sapwood, disrupting the transport of nutrients and water in the tree. If enough EAB infest a tree, the tree’s transport system will be destroyed and the tree will die. EAB has destroyed millions of ash trees in other states. In 2009, EAB was found in St. Paul, MN. Since then communities have been developing plans to respond to EAB infestation. In Fall 2010, the city’s contracted Forester, Andy Hovland, presented background information on EAB and gathered input from the Parks and Recreation Commission and the Environmental and Natural Resources (ENR) Commission. Staff and Forester drafted an EAB Plan and presented it to these commissions in March 2011. Some of the commission comments and suggestions have been incorporated into the current draft EAB Plan (Attachment 1). The Park Commission supports the plan. The ENR Commission supports the plan except for its recommendation for possible use of pesticide. The plan recommends using a combination of management strategies including inventory, inspection, strategic removal, possible use of insecticide, biological control, and replanting. We’d like to highlight four of the strategies here. Tree Inventory In 2010, the city had a contractor inventory trees in manicured areas of all our parks. Of the 2507 park trees, 484 (19.3%) are ash. This information enables us to estimate potential financial impacts of EAB (see costs below). In 2010, staff began conducting a sampling inventory of boulevard trees and collected data on 1200 trees. This sampling will continue in 2011 until we have inventoried 2000 trees, a statistically appropriate quantity that will allow us to estimate the number of ash trees on boulevards. This data will enable us to estimate costs for removing and replanting boulevard ash trees. PacketPageNumber5of194 The EAB Plan recommends that the city go beyond the sampling inventory and do a complete boulevard tree inventory. The complete inventory includes information on each tree including location, species, diameter, and condition. Having this data would enable us to include preemptive removal in our management strategy (see below). For example, our park tree inventory shows that 72 of the 484 park ash trees are in poor condition. The city could begin removing ash trees that are in poor condition, before EAB is established in a park. This approach can help slow the spread of EAB and spread out costs over time. In addition to helping us better manage EAB, a boulevard tree inventory provides baseline data for the city’s overall tree plan. The inventory data can be mapped and the data used to set urban forestry goals. The inventory will help us compete for grants since we would have the data needed to do preemptive removals based on health. The estimated cost for a complete boulevard tree inventory is $25,000-$32,000. This could be funded from the city’s Tree Fund, if projected $26,000 revenue comes through in 2011. Strategic Removal The plan proposes that ash trees be removed when they die or when they are infested. In addition, the plan recommends preemptive removal of ash. EAB populations in an area build over the course of several years, and then many trees begin dying. Instead of waiting until trees die or are infested, many communities are removing ash that are in poor condition. It is believed that this strategy helps slow the spread of EAB since EAB are likely to infest weaker trees first. In addition, this approach helps spread removal and replanting costs over several years. If grants are available for removal and replanting, the city would be able to take advantage of that funding prior to EAB being found in Maplewood. The park tree inventory provides the data we need to begin removing park ash trees in poor condition. Both the Parks Commission and Environmental and Natural Resources Commission supported this and thought the city should begin removal and replanting soon. In addition to removing ash based on health, the plan recommends preemptive removal of ash trees by area to slow the spread of ash from neighborhood to neighborhood. For example, if there is an infestation in a neighborhood, it may be helpful to remove ash trees adjacent to the infestation area. Pesticide Use Pesticide treatments are available that kill emerald ash borer and can save individual ash trees. The EAB Plan-Appendix C provides links to several references on EAB pesticides. The Park Commission supports minimal, judicious use of pesticides to preserve some park ash trees. The ENR Commission unanimously strongly opposes the use of pesticides to preserve ash trees on city land. Commission discussions focused on two chemicals—Imidacloprid and Emamectin benzoate. There is much data showing that Imidacloprid negatively impacts insects, birds, wildlife and, when used as spray application, may affect groundwater. There is less data available about the 2 PacketPageNumber6of194 environmental impacts of Emamectin benzoate. The ENR Commission has prepared a document (Attachment 2) summarizing their concerns and the environmental fate of these chemicals. A summary of impacts from three entomologists is also attached (Attachment 3). Staff and City Forester share the commissioners’ concerns regarding potential negative impacts of treating EAB with insecticides. These chemicals will kill insects that feed on treated trees— both beneficial insects as well as those considered pests. Note, however, that we believe the use of trunk injection (rather than soil drenching), greatly reduces the likelihood of these chemicals affecting ground water, surface water, and aquatic species. There is one situation where the city may want to consider limited, judicious use of Emametin benzoate, via trunk injection, for EAB control: 1. If it becomes evident that biological control for EAB will be effective in this region, and 2. If state agencies and EAB experts believe that we can prevent wholesale loss of ash trees in the region by a combination of monitoring, strategic removal, biocontrol, and insecticide treatment, and 3. If we use the pesticide strategically to manage the population of EAB, not to save a particular tree. If EAB experts believe the Twin Cities will ultimately loose all or most of its ash trees, staff and Forester agree with the ENR Commission that the environmental risks of pesticide use outweigh the environmental benefits. Replanting The EAB Plan calls for replanting at least one tree for every ash tree removed. Increasing tree diversity at several levels--street, neighborhood, and citywide--should be a key element in our replanting program. The tree inventory data would allow us to map tree species on boulevards and set diversity goals. Maplewood’s ordinance prohibits planting trees in the right-of-way. Staff would like to work with commissions to review that policy and develop a city-wide tree plan that includes goals for species diversity. Anticipated Costs The park tree inventory data enables us to estimate long term costs for removal and replacement of park ash trees. The costs below assume the city negotiates quantity discounts with a contractor. 484 park ash trees $200-$250 per tree removal $200-$350 per tree for replacement $193,600 to $290,400 Total to remove and replace park ash trees When the sampling of 2000 boulevard trees is completed this summer, we will be able to estimate removal and replacement costs for boulevard trees. An average estimate for pesticide treatment is $7 per diameter inch. (Milwaukee paid $3.12 per inch to treat 13,206 in 2009, but other references indicate $7-$16 per inch.) Cost to treat 25 trees (12” diameter): $2100 Cost to treat those 25 trees, 5 times (prolongs life 10-15 years): $10,500 3 PacketPageNumber7of194 Cost to remove and replant those 25 trees: $10,000 - $15,000 Funding The city will need to develop a funding strategy to cover EAB. Sources could include grants, general levy, fees, city’s tree fund, and tree donations. There may be a call for proposals for EAB grants in Fall 2011. The city could be in a position to apply for funding to begin preemptive removal of and replacement of ash in that round of grants. RECOMMENDATION Staff requests that the City Council provides input on the proposed Emerald Ash Borer Management Plan. Based on council’s comments, staff will bring a final plan to City Council in May. It would be especially helpful for staff to have some preliminary guidance on boulevard tree inventory, strategic removal, and pesticide use. Attachments: 1. Emerald Ash Borer Management Plan – Draft April 19, 2011 2. April 20111 Memo from Environmental Commission 3. Frequently Asked Questions Regarding Potential Side Effects of Systemic Insecticides Used to Control EAB 4 PacketPageNumber8of194 Attachment 1 EmeraldAshBorerManagementPlan CityofMaplewood,Minnesota Draft:April19,2011 I.Purpose ThepurposeofthismanagementplanistoaddressandplanfortheeventualinvasionofEmeraldAsh Borer(EAB)intoMaplewoodurbanforests.Thegoalofthisplanistoslowthespreadoftheinfestation througheducation,inspection,andstrategicmanagement.Bydefiningandbeginningmanagement nowwehopetolessendisruptiontooururbanforest,stretchthemanagementcostsassociatedwith EABoveralongerperiodoftime,andcreateanatmosphereofEABawarenesstodetectaninfestation asearlyaspossible. II.Applicability tieswhereEABmay ThisplanisapplicabletoallpubliclandinMaplewoodandallprivateproper negativelyimpactpublicareasorgenerallythreatentheoverallhealthofDĂƉůĞǁŽŽĚ͛Ɛurbanforest. III.Administration DĂƉůĞǁŽŽĚ͛ƐCityForesterandNaturalResourcesCoordinatorwillberesponsibleforimplementing thisprogram,withsupportfromParksandRecreationDepartmentandPublicWorksDepartment. IV.EABBackground EmeraldAshBorer(EAB)isanonnativebeetlethatcauseswidespreaddeclineanddeathofashtrees. ThelarvalstageofEABfeedsonthetissuebetweenthebarkandthesapwood,disruptingthe transportofnutrientsandwaterinthetrees.Ifinfestationishighenoughinanindividualtree,the damagewillbesevereenoughtokillthetree.EABhasdestroyedmillionsofashtreesinotherstates. (SeeAppendicesA,B,andCformoreinformation.) V.EABStatusinMinnesota In2009,EABwasfoundinsouthernMinnesotaandinSt.Paul.TheinfestationinSt.PaulwasintheSt. AnthonyareaandontheUniversityofMinnesotaSt.PaulCampus.SubsequentlyEABwasfoundin Minneapolis,intheTowerHillandProspectParkareas.Themetroinfestationsareabout1mileapart. TheMinnesotaDepartmentofAgriculture(MDA),MinnesotaDepartmentofNaturalResourcesand UniversityofMinnesotahavehelpedcoordinatetheresponsetotheinfestationandeducation.InSt. Paulthisincludedashtreeremovalintheinfestedareasaswellaspreemptiveremovalofashin selectedneighborhoods.In2010,theMDAreleasedbiologicalcontrolagents(threespeciesofwasps) planstodoareleaseinthemetroareain2011. atthesiteofthesouthernMNinfestation.TheMDA VI.EABManagementStrategies WhenEABwasfirstfoundinMinnesota,itwasbelievedthatwewouldeventuallyloseallashtreesin Minnesota.ButEABmayspreaddifferentlyinMinnesotathanithasinotherstates,sinceitappears thatwehavefounditrelativelyearlyintheinfestation.SLAM(SlowAshMortality)isanapproachto EABthatfocusesonslowingashtreemortalitythroughintegratedmanagementstrategies.Itmay involveacombinationofmonitoringforEAB,preemptiveremovalofashtrees,insecticidetreatment, andbiologicalcontrol.SlowingthespreadofEABandslowingashtreemortalityenablesustospread managementcostsoveralongertimeperiod.Inaddition,withbiologicalcontrolnowapossibility,the outlookforashinMinnesotacouldbedifferentthaninitiallypredicted. 1 PacketPageNumber9of194 Attachment 1 VIʹ1EABManagement:TreeInventory AtreeinventoryisthefoundationofanEABplanandprovidesthebaselinedataforaĐŝƚǇ͛Ɛurban forestryprogram.Thedatacanalsobeusedtotrackmanagementofindividualtrees,similartothe wayacitytracksinfrastructuremaintenance(ex:stormsewerstructures). In2010,MaplewoodhiredS&STreeSpecialiststoconductacompleteinventoryforpark(not preserve)treesincludinglocation,species,diameter,andhealth.Onlymanicuredareasofparkswere inventoried.Maplewoodparkshave2507trees,484ofwhichareash(19.3%).In2010,staff inventoriedasamplingofboulevardtrees.Theprotocolbeingusedrequiresweinventoryaminimum of2000boulevardtreesinordertoestimatehowmanytreeswehaveonboulevards.Thissampling willbecompletedin2011. Theboulevardsamplingandthecompleteparktreeinventoryprovidedatathatenablesusto understandthepotentialfinancial,aesthetic,andecologicalimpactsofEABinMaplewood.Buta completeboulevardtreeinventory,withinformationonthehealthofeachtree,isrequiredforthecity tostrategicallytargetindividualtreesfortreatmentorremoval,andtomakeplantingdecisionsthat ensuretreediversity. tthecityhireacontractortodoacompleteinventoryofboulevard Itisstronglyrecommendedtha trees.Inaddition,itisrecommendedthatstaffconductinformalinventoriesonafewnaturalareasin thecitytoobtainsomebasicinformationabouttheashpopulationinforestedareas. VIʹ2EABManagement:Inspection,Detection,andMonitoring Thegoalofdetectionistofindinfestationsasearlyaspossible.Onceaninfestationcenterisfound, weneedtodeterminethedurationandouterboundariesoftheinfestation.Manypeopleshouldbe involvedindetection. 1.CityForester.Maplewoodcontractsaparttimeforestertoinspectpropertiesforoakwiltand DutchElmDisease.TheĨŽƌĞƐƚĞƌ͛ƐcontractshouldbeexpandedtoincludeEABdetectionand inspection.Inaddition,theCityForestershouldbethepersonresponsiblefordelineatingthe infestationboundaries. 2.CityStaff.CitystaffneedtobekeyplayersindetectingEAB.Itisrecommendedthatstaffatthe naturecenterandparksandpublicworkscrewmembersundergoEABtrainingsotheycanhelp monitortheashtreesintheareaswheretheywork.Inaddition,itisrecommendedthatEAB trainingbeprovidedforallemployeesinterestedinlearningabouttheinsectanditsthreat. 3.ResidentsandtheMaplewoodTreeHotline.ResidentswilloftenbefirsttodetectEABonprivate lands.IftheyhaveatreewithsuspectedEAB,theyareencouragedtoreviewEABinformation onlineand/orcalltheMaplewoodTreeHotline.Thecityforesterrespondstoallcallsanddoesa tEABduringthephoneconversation. sitecheckifheĐĂŶ͛ƚruleou 4.ArrestThePestHotline.ThestatemaintainsanArrestthepesthotline.Citizenscancallthe hotlinetoreportasuspectedincidenceofEAB. 5.MinnesotaForestPestFirstDetectorNetwork.ThefirstdetectornetworkistheƐƚĂƚĞ͛Ɛearly warningsystemforinvasivetreepests.FirstdetectorscanhelpverifythepresenceofEAB. 6.MinnesotaTreeCareAdvisors.Thetreecareadvisorprogramisanetworkoftrained,community basedvolunteerswhopromoteurbanandcommunityforestrytoallresidentsofMinnesota.This programisrunbytheUniversityofDŝŶŶĞƐŽƚĂ͛ƐDepartmentofForestry. 2 PacketPageNumber10of194 Attachment 1 7.Citizenmonitoringprogram.SomeMaplewoodresidentshaveexpressedinterestinlearning moreaboutEmeraldAshBoreranditspotentialimpacttothecityandthelandscapesaroundtheir homes.ThecityshouldencourageinterestedresidentstoparticipateintheForestPestFirst DetectorprogramortheMinnesotaTreeCareAdvisorprogramsotheycanhelpthecitywatchfor EAB.Thecityshouldconsiderpayingthetuitionforresidentsintheseprogramsiftheycommitto volunteeringhoursforinspectingsitesinthecityforEAB. 8.PurpleTraps.In2010,theMinnesotaDepartmentofAgriculturesetpurpletrapsthroughoutthe state,includinginMaplewood.ThepurposeofthetrapsistohelptheMDAbetterdeterminethe extentoftheEABinfestation.ThecityshouldcontinueworkingwiththeMDAtohavethesetraps setinMaplewood. VIʹ3EABManagementTreeRemoval Whenashtreesdieordeclinetheybecomehazardsnearboulevards,buildings,andplayareas.Most deadtreesandhazardtreeswillneedtoberemoved.Butstrategicremovaloftreesbeforetheydie, whethertheyareinfestedornot,shouldalsobeapartoftheĐŝƚǇ͛ƐEABmanagementstrategy. StrategicremovalhelpsspreadoutremovalandreplantingcostsandmayhelpslowthespreadofEAB. Thecityshouldusefourremovalstrategies: 1.ZĞŵŽǀĞƚƌĞĞƐƚŚĂƚĚŝĞ͘Sometreesmaynotbedetectedearlyintheinfestationprocesssothey willberemovedwhentheydie.Onboulevardsandinlandscapedareaofparks,alldeadashtrees tbefeasibletoremovealldeadashtreesand shouldberemoved.Innaturalareas,itwillno deadfallshouldbeaddressedonasitebysitebasis.Onprivatesites,ownersshouldremovedead treesthatarehazardoustopeopleorstructures. 2.ZĞŵŽǀĞƚƌĞĞƐƚŚĂƚĂƌĞŝŶĨĞƐƚĞĚ͘Agooddetectionprogrammustbeinplacetousethisremoval strategy.Typicallyinfestationcentersarenotdetectedfor35yearsafterinsectsarrivedueto subtletiesofinitialsignsinthetree.Whenaninfestedtreeisidentified,surroundingtreeswill needtobesurveyedtodeterminetheextentofinfestationandthenumberoftreesthatwillneed toberemoved.ThecityshouldconsultwiththeMDAwheninfestationsareinitiallyidentified. 3.ZĞŵŽǀĞƚƌĞĞƐƉƌĞĞŵƉƚŝǀĞůǇďĂƐĞĚŽŶŚĞĂůƚŚ͘Selectiveremovalofpublicashtreesbasedon healthconditionshouldbeapartoftheĐŝƚǇ͛ƐEABstrategy.Inordertousethisstrategythecity willhavetocompleteaboulevardtreeinventory,includinghealthinformationforeachtree.The cityhasthisdataforparktrees.Theashtreesthatwouldbeconsideredforremovalinclude: a.UnhealthyƚƌĞĞƐͶŝŶǀĞŶƚŽƌŝĞĚtreesthathaveaconditionratingoffourorless(outoften). b.Treesthatareunsafeduetopoorhealthorstructureandarelocatedwheretheyarelikely todamagepeopleand/orproperty(hazardtrees). c.Treesthatareinconflictwithutilities. d.Treesthatarepoorlylocatedand/orrequireexcessivemaintenance. Ifseveraltreeswillberemovedpreemptivelyfromaparkoraneighborhood,thefullsiteimpacts shouldbeconsideredpriortoremoval. 4.ZĞŵŽǀĞƚƌĞĞƐƉƌĞĞŵƉƚŝǀĞůǇŝŶĂŶĂƌĞĂ.Preemptiveremovalbyareamaybeappropriatein situationssuchas: stinginfestationandtherearea a.Whenalargepopulationofashtreesisnearanexi significantnumberoftreesinpoorcondition. b.Inconjunctionwithapublicworksprojectifthehealthofashtreesonastreetwouldbe negativelyimpactedbytheprojectandmakethemmoresusceptibletoEAB. c.InconjunctionwithadjacentcitiesorregionalstrategiestomanageEAB. 3 PacketPageNumber11of194 Attachment 1 Apriorityremovallistshouldbedevelopedandrevisedregularly.Intargetingtreesforremoval,the followingshouldalsobeconsidered: 1.Proximityofashtreeremovalstocurrentinfestationcentersandtheiranticipatedspread. 2.Thenumberoftreesinpoorconditionthatarelocatedneareachother. 3.Spreadingoutremovalcostsoverseveralyears. VIʹ4EABManagement:PesticideTreatment InsecticidesareavailableformanagingEAB.Whentimedappropriately,thesetreatmentscancreatea toxicenvironmentfortheEmeraldAshBorer,killingdispersingadultsaswellaseggsandlarvae.High valueashtreescanbepreservedfromEABwithconsistenttreatmentsovertime.(SeeAppendixCfor referencesonEABinsecticides.)TherearetwoprimarymethodsofpesticideapplicationforEAB:soil drenchingandtrunkinjection.Insoildrenching,theinsecticideisappliedtothesoilunderthetree canopyandthetreerootstakeitin.Intrunkinjection,aholeisdrilledintothetreetrunkandthe chemicalisinjectedintothetissuesunderthebark.Witheithermethod,thechemicalisdispersed throughoutthetree.Emeraldashborers(andotherinsects)feedingonthetreeingestthechemical andarekilled. PesticidetreatmentaspartofEABmanagementhassomebenefits: 1.RepeatedpesticidetreatmentcanpreventEABinfestationinahealthyashtree. 2.Pesticides,inconjunctionwithtreeremoval,canbeusedtoslowashmortalityandtoreduce availablephloemtoEABlarvae. gingEAB.Using 3.Newtoolsmaybecomeavailableinthefuturethataremoreeffectiveatmana pesticidestopreservehigherqualityashtreesbuystimeforpotentialdevelopmentofnew treatments. 4.Withrepeatedtreatment,someofthelargerashtreesmayberetainedwithalltheirbenefits includingreductioninseasonalheatingandcoolingcosts,waterabsorption,carbonsequestration, wildlifevalue,andimprovedpropertyvalues. EABpesticideshaveseveralnegativeenvironmentalimpacts: 1.ImidaclopridandEmamectinbenzoate,theactiveingredientsofthetwomostcommonchemical treatmentsforEAB,havepotentialnegativeimpactstowildlife.Theseinsecticidesarenon selectiveandbroadspectrum,thus,theyhavethepotentialtoharmbothtargetedandbeneficial insects. a.Imidaclopridistoxictobirdsandwildlife,mildlytoxictofish,andhasbeenlinkedto eggshellthinninginbirds(EPAOfficeofPesticidePrograms,1994,Pesticidefactsheet: Imidacloprid,Washington,D.C.,March18.). b.Itappearsthatimidaclopridisacutelytoxictoearthwormsandhoneybees.(EPAOfficeof PesticidePrograms,1994,Pesticidefactsheet:Imidacloprid,Washington,D.C.,March18; Zang,Y.etal.2000,Genotoxicityoftwonovelpesticidesonearthworm,Eiseniafoetida. Chemosphere39:23472356.). c.Theinertingredientsfoundinimidaclopridincludetwoprovencarcinogens:crystalline dnaphthalene(InternationalAgencyforResearchonCancer,1997,Silica, quartzsilicaan http://193.51.164.11/htdocs/Monographs/Vol68/SILICA.HTM;NationalToxicology Program,Undated,Toxicologyandcarcinogenesisstudiesofnaphthalene(CASNo.9120 3)inF344/Nrats(inhalationstudies)). TR500.). 4 PacketPageNumber12of194 Attachment 1 d.EmamectinďĞŶǌŽĂƚĞ͛ƐMSDSlabelindicatesitishighlytoxictofish,mammals,andaquatic invertebrates. 2.Imidaclopridhasahighpotentialofleachingintogroundwater.ItisclassifiedbytheEPAin categoryIashavingthehighestleachingpotential.Comparedwithelevenotherpopular pesticides,Imidaclopridmovedmorequicklythroughsoilthananyoftheotherpesticidestested. (Vollner,L.andD.Klotz.,1997,Leachinganddegradationofpesticidesingroundwaterlayers; Environmentalbehaviorofcropprotectionchemicals,Vienna,Austria,InternationalAtomicEnergy Agency,pp.187203.) Thecostofpesticidesmustalsobeconsidered.Atreemustbetreatedforthedurationofitslife. Frequencyoftreatmentvarieswithproductfromannuallytoeverytwotofouryears.Ifatreewill eventuallyberemoved,itmaynotbeworthinvestingintreatmentfortheshortterm.Thismay dependonthenumberofotherpotentiallyinfestedashtreesthecityismanagingatonetimeandthe proximityofaconfirmedinfestationcenterfromthetreeinquestion. DĂƉůĞǁŽŽĚ͛ƐParksandRecreationCommissionsupportsminimal,judicioususeofpesticideto manageEABinparktrees.DĂƉůĞǁŽŽĚ͛ƐEnvironmentalandNaturalResourcesCommissionis unanimously,stronglyopposedtothecityusinginsecticidestotreatEAB.Commissionersare concernedabouttheknownenvironmentalimpacts,aswellasthefactthatlittleisknownabouthow someofthechemicalsinteractintheenvironment. WhenEABwasfirstfoundinMinnesota,itwaspredictedthatallashtreesinthestatewouldbelost. ychangehowEAB But,biologicalcontrolwasintroducedin2010,andifthatproveseffective,itma spreadsinMinnesota.Ifbiologicalcontroliseffective,andifevidencebecomesavailablethatwemay beabletosavemanyashtreesthroughacombinationofmanagementƐƚƌĂƚĞŐŝĞƐͶŝŶƐĞĐƚŝĐŝĚĞ͕ biologicalcontrol,andstrategicƌĞŵŽǀĂůͶƚŚĞcityshouldconsidertheuseofinsecticidetreatmentfor EAB.Underthisscenario,thecitywouldusepesticidetomanagethepopulationofashandthespread ofEAB,nottoselectivelysaveparticulartrees. Ifpesticidesareusedoncitypropertyandrightofway,onlytrunkinjectionshouldbeallowed.The ĐŝƚǇ͛Ɛeducationalliteratureforhomeownersshouldclearlypointoutthenegativeimpactsofpesticide useandrecommendthathomeownersneverusesoildrenchtreatmentsforEAB. VI5EABManagement:BiologicalControl TheMinnesotaDepartmentofAgricultureconsidersbiologicalcontrolthebestoptionofcost effective,longtermmanagementofEAB.In2010,theMDAreleasedwaspsthatkillEABeggsorlarvae inHoustonCounty,insoutheastMinnesota.Thisreleasewillbemonitoredtodetermineitsefficacy. TheMDAplanstodoareleaseinspring2011neartheinfestationinMinneapolisandSt.Paul. dixDcontainsinformationonbiologicalcontrolforEAB.IfbiologicalcontrolforEABproves Appen effective,thecityshouldcoordinatewiththeMDAforreleaseofthesebiocontrolagentsin Maplewood. VIʹ6EABManagement:WoodDisposalandUtilization EABcanspreadthroughtransportationofashǁŽŽĚͶŝŶlogs,treewaste,chipsorfirewood. RestrictingthemovementofashwoodcanhelpslowthespreadofEAB.RamseyCountyandselected countiesinMinnesotaareunderanashquarantinewhichprohibitsmovementofashoutofthe county.Thequarantinerestrictsmovementoffirewoodofalldeciduousspecies.Businessesthat 5 PacketPageNumber13of194 Attachment 1 needtomovetherestricteditemsacrosscountylinesmayapplyforComplianceAgreementthat indicateshowtheywilltreattheregulatedarticlestomitigatethespreadofEAB. Iflargenumbersofashdie,itisessentialtolookforwaystodisposeoforutilizeashwood. Informationcontinuestobepublishedonpotentialmarketsforurbanwoodutilization.Possibleuses forashwoodincludefuel(biomassenergychips),mulch,pulpwood,andsawlogs.Thecityshould identifylocaloptionsfordisposalandwoodutilization.Inaddition,thecityshouldseekpartnerships withnearbycitiesfordisposalandutilization. VIʹ7EABManagement:Replanting Thelossofashinoururbanforestwillhaveavisualandecologicalimpact.Itisrecommendedthatat leastonetreebeplantedforeverytreeremovedorlosttoEAB.Increaseddiversityshouldbeakey elementinourreplantingprogram.Therearedifferentmodelsforboulevardtreediversity.For example,DaveHansonfromtheUniversityofMinnesotapromotesthe102030rule:plantnomore than10%ofanyspecies,20%ofanygenus,and30%ofanyfamily.Priortomovingforwardwith replanting,thecityshoulddevelopaTreeMasterPlanthatsetsgoalsforoururbanforest,ensures diversityoftreespecieswithinneighborhoods,identifiesappropriatetreespecies,andaddresses plantingandcareguidelines. DĂƉůĞǁŽŽĚ͛ƐTreeRebateprogramprovidesacostsharematchforresidentstoplanttreesonprivate mand,ifneeded,adjustthe land.Itisrecommendedthatthecitycontinuefundingthisprogra programsoitsupportsresidentsinreplantingafterashremoval. VIIEducationandOutreach EducationandoutreachareessentialcomponentsoftheEABManagementPlan.Thecityshall developanEABeducationandoutreachprogramthat: 1.EducatesresidentssotheyunderstandthethreatsofEAB,knowwhattolookfor,knowwhattodo whentheyfindEABoradecliningashtree,understandreplantingandcareoftrees,andcanmake informeddecisionsforashtreesontheirproperty. 2.EducatesparksandpublicworksstaffsotheycanrecognizesignsandsymptomsofEAB infestation. 3.Usesdiverseforumsforeducationincluding:publicprograms,website,articlesincity publications,handouts,publicserviceannouncements,etc. 4.Providesadvancenotificationtoaneighborhoodorhomeownerofashtreemanagementthatwill occurintheirarea. 5.Provideseducationalandothersupporttoresidentsthatwishtoformneighborhoodgroupsto detectandmanageEABintheirneighborhood. 6.DevelopspartnershipwithgroupssuchasTreeCareAdvisors. VIIIOrdinanceandPolicy CitycodeshouldbereviewedandrevisedtoaccountforEAB.Twosectionsofcodeinparticularmay needrevision: 1.Section38,ArticleI.Thissectionprohibitsplantinginthepublicrightofway.Ifwehavemajor lossesofboulevardtreesourordinanceshouldallowforandencouragereplacement.Staffand CommunityDesignReviewBoardshouldreviewthispolicyandmakerecommendationstocouncil. 6 PacketPageNumber14of194 Attachment 1 2.Section38,ArticleII.Thissectionisthebasisforourtreediseaseinspectionprogram.Itallows thecitytocontrolandeliminateDutchelmdiseasefungusandelmbarkbeetlesand͞ŽƚŚĞƌ epidemicdiseasesofshadeƚƌĞĞƐ͘͟TheordinanceshouldberevisedtospecifyEmeraldAshBorer. Inaddition,thecityshoulddevelopaStreetTreeMasterPlanandpolicythataddresses: 1.Goalsforstreettrees; 2.Guidelinesanddesigntemplatesforspeciesdiversity; 3.Listofappropriatespecies; 4.Guidelinesforplantingandcare. IXLicencing/permitting AspartofEABmanagement,thecityshouldreviewrequirementsfortreecontractorslicensedinthe cityanddeterminewhetherrevisionsarenecessary. XFunding FundingwillbeneededtoimplementtheEABmanagementplan.Primarycostsinclude: 1.Boulevardtreeinventory(estimate:$25,000$32,000); 2.Cityforesterʹincreasedhoursfordetectionandinspection.DĂƉůĞǁŽŽĚ͛Ɛcityforesteris contractedfor150170hoursperyear,primarilytoinspectpublicandprivatepropertiesforoak wiltandDutchElmdisease.WewillneedasignificantincreaseinforesterhoursonceEABisfound inMaplewood. 3.Treeremoval(stafforcontractors); rs); 4.Pesticidetreatmentofselectedtrees,ifapprovedaspartoftheEABplan(stafforcontracto 5.Educationandpublicoutreach(staffandcityforester); 6.Replanting(staff,contractors,volunteers). EstimatedcostforremovalandreplantingashtreesatMaplewoodparksis$193,600to$290,400. Thisisbasedon484ashtrees,withremovalcostsof$200$250pertreeandreplantingcostsof$200 to$350pertree.Whilesmallertreesestablishwellandcatchupinsizetolargertreesinafewyears, itisthoughtthatplantinglargertreesonboulevardsandinpublicplaceshelpsreducevandalismand accidentalinjuryoftrees.Whenthesamplinginventoryofboulevardtreesiscompletedin2011,we willbeableestimateremovalandreplantingcostsforboulevardtrees. MaplewoodwillneedtosecurefundingforEABmanagement. 1.Grants.Currentlythereisnolongtermgrantfundingdedicatedtoassistingcommunitiesin MinnesotatomanageEAB.AninitialroundofgrantswasavailableforEABplanningand management.Maplewoodwillneedtostayinformedongrantopportunities.Tobecompetitive, itwillbehelpfultostrengthentheĐŝƚǇ͛Ɛurbanforestryprogram.HavinganEABplan,atree inventory,andastreettreepolicywillallbelookedatinapositivelight. illlikelyneedtousesomegeneraloperatingfundsforEAB 2.Generallevyorfees.Thecityw managementandmayneedtoconsideradditionalfees.St.Paulproposeda2%surchargeon rightofwayratesdedicatedtoEABmanagement. 3.ŝƚǇ͛Ɛtreefund.TheĐŝƚǇ͛Ɛtreefundcouldbeusedtocompletetheboulevardtreeinventoryand forsometreeplanting.Butthisfundingwillnotgofar,anditspurposeisnottocontroltree diseaseandpests. 4.Treedonations.Thefundingpackageshouldalsoconsideratreedonationprogram.Currently FriendsoftheParksandTrails(St.PaulandRamseyCounty)hastreedonationandTributeTree 7 PacketPageNumber15of194 Attachment 1 programsthatservecitiesinRamseyCounty,includingMaplewood.Publicizingtheseprograms,or creatingourowndonationprogram,willhelpprovideplantmaterialandfundsforplantingtrees atparks. XISummaryofActionsNeeded 1.Conductinventoryofboulevardtrees. 2.Developdetailsforstrategicremovalandreevaluatetheplanfrequently. 3.Developstrategiesfordisposalorutilizationofash. 4.Developandprovideeducationalandoutreachmaterialsforresidents. 5.EducatestaffinparksandpublicworkstorecognizeEAB. 6.ImplementprogramforvolunteerstohelpdetectEABinMaplewood. 7.ReviewandrevisetreediseaseordinancetoincludeEABasaforestpestthatshouldbe controlledonprivateland. 8.DevelopaTreeMasterPlanthatincludesgoalsforstreetandparktrees,guidelinesforspecies diversity,listsofappropriatespecies,guidelinesforplantingandcare. 9.SecurefundingforEABmanagement. Appendices: A.PestAlertʹEmeraldAshBorer B? B.DoIHaveEA C.EABReferences D.BiologicalControlforEAB E.WhatareothermetrocommunitiesdoingtomanageEAB? 8 PacketPageNumber16of194 9RMXIH7XEXIW Attachment 1 (ITEVXQIRXSJ%KVMGYPXYVI *SVIWX7IVZMGI 2SVXLIEWXIVR%VIE 7XEXIERH4VMZEXI*SVIWXV] 2%46 6IZMWIH7ITXIQFIV %FIIXPIJVSQ%WME EWXLIGEYWISJ[MHIWTVIEHEWL WTT XVIIHIGPMRIERHQSVXEPMX]MRWSYXLIEWXIVR 1MGLMKERERH;MRHWSV3RXEVMS'EREHE0EVZEPJIIHMRKMRXLIXMWWYIFIX[IIRXLIFEVOERH WET[SSHHMWVYTXWXVERWTSVXSJRYXVMIRXWERH[EXIVMREXVIIIZIRXYEPP]GEYWMRKFVERGLIWERHXLI IRXMVIXVIIXSHMI8IRWSJQMPPMSRWSJEWLXVIIWMRJSVIWXVYVEPERHYVFEREVIEWLEZIEPVIEH]FIIR OMPPIHSVEVILIEZMP]MRJIWXIHF]XLMWTIWX LEWFIIRJSYRHXLVSYKLSYX1MGLMKEREGVSWWQYGLSJ3LMSERHMRTEVXWSJ-RHMERE -PPMRSMW1EV]PERH1MWWSYVM4IRRW]PZERME:MVKMRME;IWX:MVKMRMEERH;MWGSRWMR-RJIWXEXMSRWLEZI EPWSFIIRJSYRHMRQSVIEVIEWSJ3RXEVMSERHMRXLITVSZMRGISJ5YIFIG8LIMRWIGXMWPMOIP]XSFIJSYRHMREHHMXMSREPEVIEWEW HIXIGXMSRWYVZI]WGSRXMRYI)ZMHIRGIWYKKIWXWXLEXMWKIRIVEPP]IWXEFPMWLIHMREREVIEJSVWIZIVEP]IEVWFIJSVIMXMW HIXIGXIH 8LIFVSEHHMWXVMFYXMSRSJXLMWTIWXMRXLI9RMXIH7XEXIWERH'EREHEMWTVMQEVMP]HYIXSTISTPIMREHZIVXIRXP]XVERWTSVXMRKMRJIWXIH VIKYPEXIXVERWTSVXSJXLIWITVSHYGXW *MKYVI%HYPXIQIVEPHEWLFSVIV %TPERMTIRRMWKIRIVEPP]LEWE]IEVPMJIG]GPI-RXLIYTTIV1MH[IWXEHYPXFIIXPIW FIKMRIQIVKMRKMR1E]SVIEVP].YRI&IIXPIEGXMZMX]TIEOWFIX[IIRQMH.YRIERHIEVP] .YP]ERHGSRXMRYIWMRXS%YKYWX&IIXPIWTVSFEFP]PMZIJSVEFSYX[IIOWEPXLSYKL *MKYVI4YVTPMWLVIHEFHSQIRSREHYPX WSQILEZIWYVZMZIHJSVQSVIXLER[IIOWMRXLIPEFSVEXSV]&IIXPIWKIRIVEPP]EVI FIIXPI QSWXEGXMZIHYVMRKXLIHE]TEVXMGYPEVP][LIRMXMW[EVQERHWYRR]1SWXFIIXPIW ETTIEVXSVIQEMRMRTVSXIGXIHPSGEXMSRWMRFEVOGVIZMGIWSVSRJSPMEKIHYVMRKVEMRSV LMKL[MRHW 8LVSYKLSYXXLIMVPMZIWFIIXPIWJIIHSREWLJSPMEKIYWYEPP]PIEZMRKWQEPPMVVIKYPEVP] WLETIHTEXGLIWEPSRKXLIPIEJQEVKMRW%XPIEWXEJI[HE]WSJJIIHMRKEVIRIIHIH FIJSVIFIIXPIWQEXIERHEREHHMXMSREPXS[IIOWSJJIIHMRKQE]FIRIIHIH FIJSVIJIQEPIWFIKMRPE]MRKIKKW*IQEPIWGERQEXIQYPXMTPIXMQIW)EGLJIQEPI TVSFEFP]PE]WIKKWHYVMRKEREZIVEKIPMJIWTERFYXEPSRKPMZIHJIQEPIQE]PE] QSVIXLERIKKW)KKWEVIHITSWMXIHMRHMZMHYEPP]MRFEVOGVIZMGIWSVYRHIVFEVO XSHE]W GEQFMEPVIKMSR0EVZEIJIIHSRTLPSIQJSVWIZIVEP[IIOWGVIEXMRKWIVTIRXMRI FIGSQIWTVSKVIWWMZIP][MHIV *MK &IIXPIKEPPIVMIWSJXIRIXGLXLISYXIVWET[SSH 8LIPIRKXLSJXLIKEPPIV]KIRIVEPP]VERKIWJVSQXSGQ*IIHMRKMWYWYEPP] GSQTPIXIHMREYXYQR 4VITYTEPPEVZEISZIV[MRXIVMRWLEPPS[GLEQFIVWVSYKLP]GQHIITI\GEZEXIH MRXLISYXIVWET[SSHSVMRXLIFEVOSRXLMGOFEVOIHXVIIW4YTEXMSRFIKMRWMR *MKYVI+EPPIV]SJERIQIVEPHEWLFSVIVPEVZE PacketPageNumber17of194 PEXI%TVMPSV1E]2I[P]IGPSWIHEHYPXWSJXIRVIQEMRMRXLITYTEPGLEQFIVSVFEVOJSVXS Attachment 1 *MK 7XYHMIWMR1MGLMKERMRHMGEXI]IEVWQE]FIVIUYMVIHJSV%TPERMTIRRMWXSHIZIPSTMRRI[P] MRJIWXIHEWLXVIIWXLEXEVIVIPEXMZIP]LIEPXL]-RXLIWIXVIIWQER]%TPERMTIRRMWSZIV[MRXIVEW IEVP]MRWXEVWJIIHEWIGSRHWYQQIVSZIV[MRXIVEWTVITYTEIERHIQIVKIXLIJSPPS[MRKWYQQIV -RXVIIWWXVIWWIHF]TL]WMGEPMRNYV]LMKL%TPERMTIRRMWHIRWMXMIWSVSXLIVTVSFPIQWEPPSVRIEVP] *MKYVI(WLETIHLSPI[LIVIER EPPPEVZEIHIZIPSTMREWMRKPI]IEV;LIXLIVE]IEVPMJIG]GPI[MPPSGGYVMR[EVQIVWSYXLIVR EHYPXFIIXPIIQIVKIH WXEXIWMWRSX]IXORS[R %TPERMTIRRMWMWREXMZIXS%WMEERHMWJSYRHMR'LMREERH/SVIE-XMWEPWSVITSVXIHMR.ETER 1SRKSPMEXLI6YWWMER*EV)EWXERH8EM[ER-R'LMRELMKLTSTYPEXMSRWSJ%TPERMTIRRMWSGGYV TVMQEVMP]MR*VE\MRYWGLMRIRWMWERH*VL]RGLSTL]PPEYWYEPP][LIRXLSWIXVIIWEVIWXVIWWIHF] HVSYKLXSVMRNYV]3XLIV%WMERLSWXW *QERHWLYVMGEZEVNETSRMGE9PQYWHEZMHMEREZEVNETSRMGE .YKPERWQERHWLYVMGEZEVWMIFSPHMEREERH4XIVSGEV]EVLSMJSPME QE]FIGSPSRM^IHF]XLMWSVE VIPEXIHWTIGMIW -R2SVXL%QIVMGE%TPERMTIRRMWLEWEXXEGOIHSRP]EWLXVIIW,SWXTVIJIVIRGISJ%TPERMTIRRMW SVVIWMWXERGIEQSRK2SVXL%QIVMGEREWLWTIGMIWQE]ZEV]+VIIREWL *TIRRW]PZERMGE ERH FPEGOEWL *RMKVE JSVI\EQTPIETTIEVXSFILMKLP]TVIJIVVIH[LMPI[LMXIEWL *EQIVMGERE ERHFPYIEWL *UYEHVERKYPEXE EVIPIWWTVIJIVVIH%XXLMWXMQIEPPWTIGMIWERHZEVMIXMIWSJREXMZI EWLMR2SVXL%QIVMGEETTIEVXSFIEXVMWOJVSQXLMWTIWX *MKYVI.EKKIHLSPIWPIJXF] %TPERMTIRRMWMRRI[P]MRJIWXIHXVIIWFIGEYWIXLI]I\LMFMXJI[MJER] [SSHTIGOIVWJIIHMRKSRPEVZEI I\XIVREPW]QTXSQW.EKKIHLSPIWI\GEZEXIHF][SSHTIGOIVWJIIHMRKSRPEXIMRWXEVSVTVITYTEP EHYPXFIIXPIWQE]FIWIIRSRFVERGLIWSVXLIXVYROIWTIGMEPP]SRXVIIW[MXLWQSSXLFEVO *MK &EVOQE]WTPMXZIVXMGEPP]SZIVPEVZEPJIIHMRKKEPPIVMIW;LIRXLIFEVOMWVIQSZIHJVSQ EVIVIEHMP]ZMWMFPI *MKERH*MK %RIPPMTXMGEPEVIESJHMWGSPSVIHWET[SSHYWYEPP]EVIWYPXSJ WIGSRHEV]MRJIGXMSRF]JYRKEPTEXLSKIRWWSQIXMQIWWYVVSYRHWKEPPIVMIW %W%TPERMTIRRMWHIRWMXMIWFYMPHJSPMEKI[MPXWFVERGLIWHMIERHXLIXVIIGERST]FIGSQIW MRGVIEWMRKP]XLMR1ER]XVIIWETTIEVXSPSWIEFSYXXSTIVGIRXSJXLIGERST]EJXIVSRP]E JI[]IEVWSJMRJIWXEXMSR8VIIWQE]HMIEJXIVXS]IEVWSJLIEZ]MRJIWXEXMSR *MK )TMGSVQMG WLSSXWQE]EVMWISRXLIXVYROSVFVERGLIWSJXLIXVII *MK SJXIREXXLIQEVKMRSJPMZIERHHIEH XMWWYI(IRWIVSSXWTVSYXMRKWSQIXMQIWSGGYVWEJXIVXVIIWHMI %TPERMTIRRMWPEVZEILEZIHIZIPSTIHMRFVERGLIWERHXVYROWVERKMRKJVSQGQ MRGL XS GQ MRGLIW MRHMEQIXIV%PXLSYKLWXVIWWIHXVIIWEVIMRMXMEPP]QSVIEXXVEGXMZIXS%TPERMTIRRMW XLERLIEPXL]XVIIWEVIMRQER]EVIEWEPPSVRIEVP]EPPEWLXVIIWKVIEXIVXLERGQMRHMEQIXIVLEZI FIIREXXEGOIH *MKYVI%WLXVIIOMPPIHF] IQIVEPHEWLFSVIV2SXIXLI WIVTIRXMRIKEPPIVMIW *SVQSVIMRJSVQEXMSRSRXLIIQIVEPHEWLFSVIVERHVIPEXIHXSTMGW 4YFPMWLIHF] 1YPXMEKIRG])QIVEPH%WL&SVIV;IF7MXI97(%*SVIWX7IVZMGI 2SVXLIEWXIVR%VIE [[[IQIVEPHEWLFSVIVMRJS 7XEXIERH4VMZEXI*SVIWXV] 97(%*SVIWX7IVZMGI[[[REJWJIHYWJLTIEF 2I[XS[R7UYEVI4% 97(%%RMQEPERH4PERX,IEPXL-RWTIGXMSR7IVZMGI [[[REJWJIHYW [[[ETLMWYWHEKSZTPERXCLIEPXL *IHIVEP6IG]GPMRK4VSKVEQ 4VMRXIHSRVIG]GPIHTETIV (IFSVEL+1G'YPPSYKL TVSJIWWSV(ITEVXQIRXWSJ)RXSQSPSK]ERH*SVIWXV]1MGLMKER7XEXI9RMZIVWMX] 2SIP*7GLRIIFIVKIV7XIZIR%/EXSZMGL *SVIWX,IEPXL4VSKVEQPIEHIVERHJSVIWXIRXSQSPSKMWX 2SVXLIEWXIVR%VIE7XEXIERH4VMZEXI*SVIWXV]97(%*SVIWX7IVZMGI (EZMH0'ETTEIVXERH,S[EVH6YWWIPP1MGLMKER7XEXI9RMZIVWMX][[[JSVIWXV]MQEKIWSVK [[2182,2949,2232,2991][9][,,][Arial]] 7XIZIR%/EXSZMGL97(%*SVIWX7IVZMGI[[[JSVIWXV]MQEKIWSVK )H[EVH'^IV[MRWOM3RXEVMS1MRMWXV]SJ2EXYVEP6IWSYVGIW[[[JSVIWXV]MQEKIWSVK *MKYVI)TMGSVQMGFVERGLMRKSR ELIEZMP]MRJIWXIHEWLXVII 97(%MWERIUYEPSTTSVXYRMX]TVSZMHIVERHIQTPS]IV PacketPageNumber18of194 Attachment 1 6SFIVX7X27X4EYP12 [[[QHEWXEXIQRYW (S-,EZI)QIVEPH%WL&SVIV# )%& 1 -XLMROQ]EWLXVIIQE]FI 7 MRJIWXIH[MXL)QIVEPH%WL&SVIV 8 ) Go to step #3 4 2 -WYWTIGX-LEZIWIIRER)QIVEPH 7 %WL&SVIV 8 ) Go to step #5 4 3 6IZMI[XLMWKYMHI 7 -WQ]XVIIEREWL# [[[QHEWXEXIQRYWRI[WTYFPMGEXMSRWI\XEWLXVIIMHTHJ 8 ) If yes, go to step #4 4 If no, go to step #7 4 6IZMI[XLMWKYMHI (SIWQ]EWLXVIILEZIW]QTXSQW 7 SJ)QIVEPH%WLFSVIV# 8 ) If yes, go to step #5 4 If no, go to step #7 5 6IZMI[XLIWIKYMHIW %VIXLIW]QTXSQWSVMRWIGXW)%& 7 PSSOEPMOIW# 8 ) If yes, go to #7 4 If no, go to #6 6 [[[JSVIWXV]YQRIHYI\XIRWMSRMRHI\LXQP 7 -XGSYPHFI)%& 8 Contact the U of M Forest Resources Insert Screen Shot When AvailableInsert Screen Shot When Available ) 4 7 [[[I\XIRWMSRYQRIHYKEVHIRMRJSHMEKRSWXMGW 7 -XMWRvX)%&WS[LEXMWMX# HIGMHYSYWEWLMRHI\LXQP 8 Visit the University of Minnesota Extension ) “What’s Wrong With My Plant” website to 4 PacketPageNumber19of194 (S-LEZI)%&JEGXWLIIXMRHH Attachment 1 AppendixC:EABReferences GeneralEABinformation www.emeraldashborer.info www.extension.umn.edu/distribution/horticulture/M1242.html www.dnr.state.mn.us/invasives/terrestrialanimals/eab/slideshow.html MinnesotaDepartmentofAgriculture: General:www.mda.state.mn.us/plants/pestmanagement/eab.aspx Managementstrategies:www.mda.state.mn.us/plants/pestmanagement/eab/eabstrategies.aspx Quarantineinformation:www.mda.state.mn.us/en/plants/pestmanagement/eab/quarantinefaq.aspx Biocontrol:www.mda.state.mn.us/plants/pestmanagement/eab/biocontrolinsemn.aspx InsecticidesforEAB: 16pageguide:www.emeraldashborer.info/files/multistate_EAB_Insecticide_Fact_Sheet.pdf EnvironmentalimpactsofImidacloprid:www.sierraclub.ca/national/programs/health environment/pesticides/imidaclopridfactsheet.shtml Impacts:www.emeraldashborer.info/files/Potential_Side_Effects_of_EAB_Insecticides_FAQ.pdf Homeownerguide: www.mda.state.mn.us/en/plants/pestmanagement/~/media/Files/plants/eab/eabtreatmentguide 2.ashx EŽƚĞͶŽŵŵŝƐƐŝŽŶĞƌGinnyYinglinghasassembledseveraltechnicalarticlesonEABinsecticidesand staffcanmaketheseavailable. PacketPageNumber20of194 Attachment 1 Appendix D: Biological Control The following text is from the Minnesota Department of Agriculture website, 3/4/11: Biological control (biocontrol) is the best option for cost-effective, long-term EAB population reduction. A variety of insecticides are available to treat individual, high-value ash trees. Cost and logistical considerations make these treatments impractical on a large scale. Biocontrol, already used successfully to fight some weed and insect pests in Minnesota, is considered the only feasible large-scale tool for combating EAB. Biocontrol reunites a target pest with the insects or diseases that control the pest in its native range. In this case, tiny, stingless wasps that control EAB in Asia are released to reduce EAB damage. Prior to their use, biocontrol organisms are thoroughly tested to ensure they will not harm humans, native plant and animal species, or the environment. USDA rears three species of wasps as biocontrol agents for EAB. Two species kill EAB larvae. Tetrastichus planipennisiadults find and insert their eggs into EAB larvae. Spathius agrili behaves similarly except that the wasp eggs and developing wasps are attached to the outside of the EAB larvae. The developing wasps feed on and eventually kill the EAB larvae. Egg parasitoid, Oobius agrili, adults insert their eggs into EAB eggs on ash bark. The developing wasps feed on and destroy the eggs. PacketPageNumber21of194 Attachment 1 AppendixE:WhatareotherMetroCommunitiesDoingtoCombatEAB? BelowarenotesonwhatnearbycommunitiesaredoingtomanageEAB. SaintPaul Removedallinfestedashtreesfrominitialinfestation CreatedtraptreestomonitorEABpopulation(destructivesamplingofash) iningash Structuredremovaloffullblocksofdecl 2011:somepesticidetreatmentininfestedareas 2011:residentswillbeallowedtohirelicensedcontractorstotreatboulevardtreesviatrunkinjection Minneapolis Removedallinfestedtrees Trunkinjectionofselectparktrees 2011:releaseofbiologicalnearinfestation RamseyCounty Removing300trees Trunkinjectionof1600treesincountyparks/golfcourses Woodbury EABplanpresentedtocouncilMarch2011 OrdinancewillbeupdatedtoincludeEAB Notrecommendingchemicaltreatmentatthistime Councilwilldeterminewhetherornottodopreemptiveremovals CottageGrove Plansfortrunkinjectionof3000blvdashtrees Plancallsforremovalof50150ashperyeardependingonseveralfactors,includingcosts Plancallsforremovalandreplacementofapproximately1000oftheir4000boulevardashtreesover 12years Possiblestructuredremovalofpoorerqualitypublicashtreesdependingonfunding Roseville CitycouncilapprovedEABplaninfallof2010 $100,000budgetedforEAB,plusreceived$50,000grant Eachyearwillremovesomeashthatareinpoorcondition Willtreatsomeashtreesconsideredsignificant Residentsmaytreatboulevardashtreesiftheyapplyforapermitandusealicensedcitycontractor Updatingdiseaseordinancetoincludeash NorthSaintPaul Allowingresidentstoregisterboulevardashtreestheywouldliketohavetreatedwiththecity Planningonsomestructuredremoval PacketPageNumber22of194 Attachment 2 To: Maplewood City Council From: Maplewood Environmental and Natural Resources Commission Date: April 18, 2011 Re: Concerns regarding use of chemical treatment to address potential Emerald Ash Borer infestations. At its March 2011 meeting, the Maplewood Environmental and Natural Resources Commission passed a resolution strongly urging the City Council not to allow the use of chemical treatments on ash trees owned by the city as part of its Emerald Ash Borer (EAB) strategy. This decision was based on several lines of reasoning: 1.Such treatments, once begun, must continue for the life of the tree, at potentially considerable expense to the city. 2.Damage to the trees as a result of injecting the chemicals (the environmentally “preferred” approach) is likely to reduce the life of the trees anyway. 3.Financial resources used for treatment would be better spent in mitigation strategies, such as thinning of ash trees on city property and boulevards to reduce the overall coverage of this species (thereby making the larger forest “less attractive” for EAB) and pre-emptive replacement with other tree species. 4.Chemical treatments may postpone, but ultimately likely will not prevent the loss of many ash trees; but chemical treatments come with potentially high environmental costs. It is these environmental costs that we have outlined in greater detail for you below (and describe in even greater detail with supporting documentation in the attached document). The two most likely chemicals to be used against EAB are imidacloprid (IM) and emamectin benzoate (EB). Both of these chemicals are highly toxic to various beneficial insects and have known and potential environmental consequences that, in our opinion, make them undesirable for use in our city: Imidacloprid (IM) 1.IM is extremely toxic to honeybees and high concentrations of IM are found by researchers in sap, pollen, and nectar of treated plants. Short-term exposure to as little as 5 nanograms (one-billionth of a gram) results in 50% mortality among honeybees. 2.While pollination by bees is not important for ash trees, in the upper Midwest the pollen from ash trees constitute nearly 40% of bees’ pollen source in April, when other sources are not yet available. 3.Studies linking IM to collapse of honeybee populations in Europe has led Italy, France and Germany to ban it and the EU to schedule it’s phasing out. 4.IM is also very toxic to beneficial predator insects such as ladybird beetles and lacewings, to aquatic insects such as mayflies and caddisflies, and to earthworms. 5.Studies suggest IM’s use in trees may actually promote infestations by unwanted insects, such as spider mites. These studies indicate such infestations are due not PacketPageNumber23of194 Attachment 2 only to the elimination of beneficial insects that prey on the mites, but also as a result of the chemicals causing greater egg production by the mites themselves. 6.Leaves from systemically treated ash and maple trees were found to inhibit feeding of decomposer organisms, such as earthworms and aquatic invertebrates. 7.IM is highly soluble so it is found in runoff from agricultural fields, in streams, and groundwater throughout North America. 8.At concentrations found in the environment, aquatic insect communities show reduced populations and biodiversity. 9.Once applied to a tree, either by soil drench or injection, IM is quickly detectable in leaves, sap, and pollen, where non-target species may be exposed to significant concentrations. 10.The breakdown products, or metabolites of IM, are often more toxic than IM itself. Emamectin benzoate (EB) 1.EB is extremely toxic to butterflies and moths and does not distinguish between “good” and “bad” species. Studies have shown it is 20- to 64,000-times more toxic to butterfly and moth catepillars than other pesticides used on the same crops as EB. 2.EB is used in agriculture as a topical (spray) treatment on a variety of crops because it has been found to be relatively less toxic to non-target insects than other pesticides (other than moths and butterflies). However, when sprayed onto plants, EB degrades rapidly in sunlight limiting exposure of non-target species. No studies were found evaluating EBs toxicity as a systemic pesticide, so it is not known what kind of exposures or affects would be experienced by non-target species when EB is used in this manner. 3.EB is also used to kill parasitic sea lice in fish farms. Studies indicate it may act as an endocrine disruptor, causing early induction of molting in lobsters and other crustaceans. Would the same be true in crawfish? There is no information. 4.EB appears to be moderately toxic to freshwater fish such as bluegill, trout and fathead minnow. 5.EB is very toxic to marine copepods, but there is no information regarding how it would affect freshwater invertebrates. 6.EB tends to bind to soil or sediment particles, making it less likely to leach to groundwater, but also making it very persistent in soil. Also, runoff carrying soil particles could carry EB to surface waters. 7.The biggest concern is the lack of information about EB as a systemic pesticide and its potential impacts in terrestrial and freshwater ecosystems. Pesticides such as IM and EB have gained favor because of their apparent low toxicity to mammals, including humans. We believe this is short-sighted. Our health and quality of life depends upon the integrity of the ecosystems in which we live. From our perspective the loss of certain insect species may seem inconsequential; from the perspective of the larger system it can be devastating. Upsetting the delicate balance between predator and PacketPageNumber24of194 Attachment 2 prey, plants and pollinators, detritus and decomposers is often considered by us to be a regrettable, but remote effect on the “lowest orders” of the animal world. In fact, it is akin to chipping away at the foundation of our home. Given the potential impacts of these chemicals on our environment (and in the case of EB the gaping holes in our knowledge regarding its potential impacts), we urge the city council to not allow the use of them on trees in our city. While chemical treatments may provide a short-term fix to the EAB problem, we believe the city would be better served by taking a holistic view of our environment that considers the indirect consequences of these toxic chemicals and adopt a long-term, preventative approach through strategic management of our forests. PacketPageNumber25of194 Attachment 2 Environmental Fate and Ecological Toxicity of Chemicals Proposed for Emerald Ash Borer Treatments Prepared for the Maplewood Environmental and Natural Resources Commission by commission member, Ginny Yingling. April 17, 2011. Imidacloprid Imidacloprid (IM) is a nicotine mimic that produces toxicity by binding to and over-stimulating certain neuron receptors, disrupting the nervous system. It binds much more readily to these receptors in invertebrates than vertebrates, giving it a higher margin of safety for humans. In insects, the disruption of the nervous system results in modified feeding behavior, paralysis and subsequent death (Mullins, 1993). IM is used against a wide variety of insect pests, including Asian longhorn beetles (maple trees), potato beetle, cockroaches, fleas on domestic pets (Advantage®), termites, turf insects, etc. While it only moderately toxic to mammals and fish, it is extremely toxic to non-target beneficial organisms, such as honeybees and earthworms (Zang, et al., 2000; Luo, 1999), and important predator insects, including ladybird beetles and lacewings (Kaakeh, et al., 1996; Mizell and Sconyers, 1992). Some studies have also shown that treatment with IM may result in infestations by other, unwanted insects, such as spider mites (James and Price, 2002; Raupp, et al., 2004; Sclar, et al, 1998). These infestations are promoted not only by the reduction or elimination of beneficial predator insects, but also by increased spider mite egg production resulting from their exposure to IM (James and Price, 2002). IM is highly water soluble and does not bind readily to soil particles (Fossen, 2006), so it may readily leach into groundwater. It is quite persistent in the environment, degrading quite slowly in water (half- 1 life = 31-46 days; Kidd and James, 1991; Tomlin, 1997) and soil (half-life = 69 – 997 days; Sarkar, et. al., 1999; Gupta, et al., 2002; Roberts and Hutson, 1999). However, when exposed to sunlight IM has a short (3 hour) half-life in surface water (Moza, et al, 1998; Wamhoff, et al., 1999), so it is less likely to be found in surface waters than groundwater. Yet, despite its rapid degradation in sunlight, investigators report detecting concentrations of 0.2, 0.4, and 1.0 parts per billion (ppb) in streams in New York, New Brunswick and Florida, respectively. Concentrations as high as 11.9 ppb have been detected in runoff from agricultural fields in Canada (CCME, 2007). IM has been detected in the groundwater in New York at concentrations up to 6.69 ppb (US EPA, 2003). Several IM breakdown products have been shown to be of equal or greater toxicity than the parent compound (Nauen et al, 1998). Despite its environmental persistence and presence in waters, very little is known about IM’s long-term chronic and short-term “pulse” effects on non-target aquatic organisms. However, in studies by Kreutzweiser, et al. (2007 and 2008), leaves from ash and maple trees treated with IM at typical field rates contained 0.8 – 1.3 and 3-11 parts per million (ppm) IM, respectively. The leaves were then added to aquatic and forest microcosms to evaluate the effect on leaf-shredding insects. While there appeared to be no effect on the invertebrates’ survival rates, the 1.3 ppm and higher concentrations caused significant feeding inhibition among aquatic insects and earthworms, as well as measurable weight loss in the earthworms. IM applied directly to the water of the aquatic microcosms, to simulate leaching from soils, was at least 10-times more toxic to aquatic insects than the IM in the leaves, with high mortality at 0.13 ppm and significant feeding inhibition at 0.012 ppm. Pestana, et al. (2009) found that both the abundance and biodiversity of aquatic bottom-feeding invertebrates was reduced by exposure to IM at concentrations of 2 and 20 ppb. They also note that IM is toxic to other aquatic insects, such as caddisflies and mayflies. Mayflies are particularly sensitive with 50% of the mayflies dying within 24- and 96-hrs of being exposed and 0.65 to 2.1ppb IM, respectively. Premature maturation and emergence of mayflies, and impaired 1 A half-life is the time it takes for half of the mass of a contaminant to degrade. PacketPageNumber26of194 Attachment 2 reproductive fitness, occurred when they were exposed to pulses of IM at concentrations of as little as 0.1 ppb (Alexander, et al., 2007 and 2008). IM rapidly moves through plant tissues after applications and can be present in detectable concentrations in the leaves, vascular fluids (sap) and pollen. Studies have shown plants grown from seeds treated with IM can have significant concentrations (up to 15 ppm in leaves of young seedlings, up to 13 ppb in pollen) of IM in their sap, pollen, flowers, and leaves (Laurent and Rathahao, 2003; Rouchaud, et al, 1994; Bonmatin, et al., 2005; Westwood, et al, 1998). As a result, many non-target insects, such as honey bees, parasitic wasps, and predaceous ground beetles sensitive to IM may be exposed as they forage for sap, pollen and nectar or feed on other insects that have been exposed. Bees are particularly sensitive to IM. Pollen constitutes the only protein source for a beehive, and its contamination can induce both contact- and oral-intoxication. Fifty percent of bees will die if they ingest 2 (ng) of IM over a short period of time (acute exposure), or just 0.01 – 1 ng over a just 5 nanograms longer period of time (chronic exposure). These values are often referred to as the LD-50, or the amount of a toxin that is a “lethal dose” (LD) to 50% of the exposed organism (Suchail, et al, 1999). When bees forage for nectar, they often become coated with pollen. The LD-50 for simply coming into contact with IM contaminated pollen is 24 ng of IM (Suchail, et al, 1999). Even if the use of IM is of short duration (spring applications), the exposure for bees in chronic, as both bees and their larvae feed on the stocked contaminated pollen and nectar, especially in the winter and early spring (Bonmatin, et al., 2005). Low doses of IM and IM-metabolites also negatively affect honeybee foraging and learning behavior (Decourtye et al, 2003 and 2004). Perhaps the most compelling evidence for the toxicity of systemic IM on honeybees is an online video at http://www.youtube.com/watch?v=e8Nsn4KvjwM . In this video, researchers compare the effects on honeybees of feeding them sap expressed from the blade tip of corn seedlings grown from IM-treated and untreated seeds. The bees fed the sap from the treated seedlings died within 2 to 5 minutes. As use of IM as a seed-dressing formulation for various crops has increased, researchers have noted a coincidental sudden and drastic decline in honeybee populations and honey production in Europe (Colin, et al., 2004). While a conclusive link has not been made, it is suspected that IM has played a major role in these declines (Bonmatin, et al, 2005) and has led several individual nations (Italy, France, Germany) and the EU to ban or phase-out the use of IM. It is often noted that ash trees largely pollinate by airborne dispersion of their pollen, and therefore do not rely heavily on bees for their pollination, suggesting that bee exposure to ash pollen (and any IM it may contain) may be minimal. However, ash trees are one of the earliest flowering trees in the upper Midwest and bees rely heavily on them as a source of food when they first begin foraging in the spring. In fact, in a PhD thesis from Wisconsin, Severson (1978) reports that ash pollen may constitute as much as 39% of the bee’s pollen source in mid-April. Emamectin Benzoate Emamectin benzoate (EB) belongs to a class of pesticides called avermectins, which disrupt the transmission of nerve impulses, resulting in paralysis and death of the target organisms. Recent studies also suggest that EB has the ability to induce premature molting in insects, suggesting it is also an endocrine disruptor (Bright, et al., 2005). Avermectins are broad spectrum toxicants for nematodes and insects. EB was developed as a lepidoptericide, so it is extremely toxic to moths and butterflies. A Canadian study found EB is also toxic to green algae at relatively low concentrations (3.9 ppb; OPP, 2000). It also appears to be moderately toxic to freshwater fish, such as bluegill, trout, and fathead 2 A nanogram is one billionth of a gram PacketPageNumber27of194 Attachment 2 3 minnow, with LC-50 values of 180, 174, and 194 ppb in water, respectively (OPP, 2000). Irreversible, toxic effects on marine copepods were observed at water concentrations as low as 0.12 ppb and significant reduction in egg production was observed at 0.158 ppb (Willis and Ling, 2003). EB appears to be relatively non-toxic for birds and mammals (Bright, et al, 2005). In the environment, EB tends to bind to soil or sediment particles (SPAH, 2002), making it less likely than IM to leach into the groundwater, but more likely to be washed into surface water with runoff carrying sediment. Studies have shown it to have a half-life in soil of 174 – 427 days (the lower the oxygen levels in the soil, the longer EB persists). EB is very stable in water, although if exposed to sunlight it has a half-life of 1.4 – 22 days (Bright, et al, 2005). EB has been used as a topical (spray) treatment in a wide variety of agricultural crops such as cotton, tobacco, cabbage, potatoes, etc. where it is used primarily to kill “chewing and sucking pests”, such as aphids, leafhoppers, tobacco budworms, southern armyworm, potato beetle, and whiteflies. Its agricultural uses have increased in recent years because it is relatively less harmful to beneficial insect species than other avermectins when applied as a spray (Sechser, et al., 2003; Lasota and Dybas, 1991). However, no studies were found evaluating the effects of EB when used as a systemic pesticide. In recent years, EB has been used to kill parasitic sea lice which infect salmon in fish farms. Studies have indicated that the high doses found in fish feed and feces beneath the fish pens may have adverse effects on the molting cycle and reproductive success of lobsters (Waddy, et al., 2010). This may have implications for the development and subsequent reproduction of other crustaceans (such as freshwater crawfish), beneficial insects, and other invertebrates, but no studies have been done to evaluate this. EB has also been detected in blue mussels up to 100 m from the fish pens, but it does not appear to persist in them once the source has been removed (Telfer, et al., 2006). No studies were found to have been conducted on freshwater bivalves to determine whether they would be similarly affected if exposed to EB. The main concern surrounding EB is the lack of information regarding how it will behave when used as a systemic pesticide in trees (or other plants) and the general absence of information regarding its effects on freshwater organisms. References cited: Alexander, AC., Culp, MN, Liber, K. and Cessna, AJ (2007) Effects of insecticide exposure on feeding inhibition in mayflies and oligochaetes. Env. Toxicol. & Chem., 26:1726-1732. Alexander, AC., Heard, KS, and Culp JM (2008) Emergent body size of mayfly survivors. Freshwater Biol., 53:171-180. Bonmatin, JM, et al. (2005) Quantification of imidacloprid uptake in maize crops. Jour. Agric. Food Chem., 53:5336-5341. Bright, DA and Dionne, S. (2005) Use of Emamectin Benzoate in the Canadian Finfish Aquaculture Industry: A Review of Environmental Fate and Effects. Prepared for Environment Canada. March 2005. Burridge, L.E., et al. (2004) Acute toxicity of emamectin benzoate (SLICE) in fish feed to American lobster, Homarus americanus. Aquacult. Res., 35:713-722. 3 LC-50, the 50% lethal concentration, is similar to LD-50, but refers to the concentration (rather than dose) of a toxin in water, soil, or food, at which 50% of exposed organisms will die. PacketPageNumber28of194 Attachment 2 CCME (2007) Canadian Water Quality Guidelines: Imidacloprid. Scientific Supporting Document. Canadian Council of Ministers of the Environment, Winnipeg. Conlin, M.E., et al. (2004) Qunatitative analysis of the foraging activity of honeybees: relevance to the sub-lethal effects induced by systemic insectides. Archive Environ. Contam. Toxicol., 47:387-395. Decourtye, A., Lacassie, E. and Pham-Delegue, MH (2003) Learning performances of honeybees (Apis mellifera L.) are differentially affected by imidacloprid according to the season. Pest Management Sci., 59:269-278. Decourtye, A., Devillers, J., Cluzeau, S., Charreton, M. and Pham-Delegue, MH (2004) Effects of imidacloprid and deltamethrin on associative learning in honeybees under semi-field and laboratory conditions. Exotoxicol. Environ. Safety, 57:410-419. Fossen, M (2006) Environmental Fate of Imidacloprid. Department of Pesticide Regulation, Sacramento, CA. April 2006. Gupta, S., et al (2002) Leaching behavior of imidacloprid formulations on soil. Bull. Environ. Contam. Toxicol., 68:502-508. James, DG and Price, TS (2002) Imidacloprid Boosts TSSM Egg Production. Agrichem. & Env. News, Issue 189. Washington State Univ. Extension Service. Kaakeh, N., Kaakeh, W, and Bennet, G (1996) Topical toxicity of imidacloprid, fipronil, and seven conventional insecticides to the adult convergent lady beetle (Coleoptera: Coccinellidae). Jour. Of Entomol. Sci, 31(3): 315-322 Kidd H. and James DR (1991) The Agrochemicals Handbook, Third Ed. The Royal Society of Chemistry. Unwin Brothers Ltd., Old Woking, Surrey, UK. Kreutzweiser, D., Good, K., Chartrand, D., Scarr, T., and Thompson, D. (2007) Non-target effects on aquatic decomposer organisms of imidacloprid as a systemic insecticide to control emerald ash borer in riparian trees. Ecotoxicol. Env. Safety, 68:315-325. Kreutzweiser, DP, Good, KP, Chartrand, DT, Scarr, TA, and Thomspon, DG (2008a) Are leaves that fall from imidicloprid-treated maple trees to control Asian longhorned beetles toxic to non-target decomposer organisms? Jour. Env. Quality, 37:639-646. Kreutzweiser, DP, Thomspon, DG, and Scarr, TA (2008b) Imidicloprid in leaves from systemically treated trees may inhibit litter breakdown by non-target invertebrates. Ecotoxicol. & Env. Safety, 72:1053-1057. Kreutzweiser, et al. (2008c) Toxicity of the Systemic Insecticide, Imidacloprid, to Forest Stream Insects and Microbial Communities. Bulletin of Environmental Contaminant Toxicology, 80:211-214. Lasota, JA and Dybas, RA (1991) Avermectins, a novel class of compounds: Implications for use in arthropod pest control. Ann. Rev. of Entomol., 36:91-117. 14 Laurent, FM and Rathahao, E. (2003) Distribution of C imidacloprid in sunflowers (Helianthus annuus L.) following seed treatment. Jour. Agric. Food Chem., 51:8005-8010. Luo, Y. (1999) Toxicological study two novel pesticides on earthworm, Eisenia foetida. Chemosphere, 39:2347-2356. PacketPageNumber29of194 Attachment 2 Mizell, RF and Sconyers, MC (1992) Toxicity of imidacloprid to selected arthropod predators in the laboratory. Florida Entomol., 83:1806-1812. Moza, PN, Hustert, K., Fesicht, E. and Kettrup A. (1998) Photolysis of imidacloprid in aqueous solution. Chemosphere. 36(3):497-502. Mullins, JW (1993) Imidacloprid: A new nitroguanidine insecticide. Am. Chem. Soc. Symposium Series 5240097-6156. Nauen, RK, Tietjen, K., Wagner, K. and Elbert, A. (1998) Efficacy of plant metabolites of imidacloprid againstMyzus persicae and Aphis gossypii (Homoptera: Aphididae). Pestic. Sci., 52:53-57. OPP, 2000 Pesticide Ecotoxicity Database (Formerly: Environmental Effects Database (EEDB). Data retrieved from USEPA Ecotox database. Office of Pesticides Program. Pestana, J., et al. (2009) Structural and functional responses of benthic invertebrates to imidacloprid in outdoor stream mesocosms. Env. Pollution (2009). Raupp, MJ, Webb, RE, Szczepaniec, A., Booth, D., and Ahern, R. (2004) Incidence, Abuncance and Severity of Mites on Hemlocks Following Applications of Imidacloprid. Jour. of Arboriculture, 30(2):108-113. Roberts, TR and Hutson, DH (eds) (1999) Chlorpyrifos. In: Metabolic Pathways of Agrochemicals, Part 2. The Royal Soc. of Chem., Cambridge, UK, pp 234-242. Sarkar, MA, et al (1999) Effect of pH and type of formulation on the persistence of imidacloprid in water. Bull. Environ. Contam. Toxicol., 63:604-609. Rouchaud, J., Gustin F., and Wauters, A. (1994) Soil biodegradation and leaf transfer of insecticide imidacloprid applied in seed dressing in sugar beet crops. Bull. Environ. Contam. Toxicol., 53(3): 344- 350. Sclar, D.C., Gerace, D., and Cranshaw, W. S. (1998) Observations of Population increases and injury by spider mites (Acari: Tetranychidae) on Ornamental Plants Treated with Imidacloprid. Jour. Econ. Entomol., 91(1):250-255. Sechser, B., Ayoub, S., and Monuir, N. (2003) Selectivity of emamectin benzoate to predators of sucking pests on cotton. Jour. of Plant Disease and Protection, 110(2):184-194. Severson, DW (1978) Pollen Gathering by Honey Bees in LaCrosse County, Wisconsin. Thesis submitted to the faculty of the University of Wisconsin. September 1978. SPAH, 2002 Potential environmental impacts of emamectin benzoate, formulated as Slice™, for salmonids. Technical Report. 36 pp. Schering-Plough Animal Health. Suchail, A, Guez, D., and Belzunces, LP (1999) Discrepancy between acute and chronic toxicity induced by imidacloprid and its metabolites in Apis mellifera. Environ. Toxicol. Chem., 20(11): 2482-2486. Telfer, T.C., et al. (2006) Environmental effects of the anti-sea lice (Copepoda: Caligidae) therapeutant emamectin benzoate under commercial use conditions in the marine environment. Aquaculture, 260: 163-180. PacketPageNumber30of194 Attachment 2 th Tomlin, C (1997) The pesticide manual: Incorporating the agrochemicals handbook, 10 ed. British Crop Protection Council, Farnham, Surrey, UK. U.S. EPA (2003) Imidacloprid; Pesticide Toerances. Fed. Regist. 68:35303-35315 [Online]. Available athttp://www.epa.gov/fedrgstr/EPA-PEST/2003/June/Day-13/p14880.htm (as cited in Fossen, 2006; verified 1-11-06). US EPA, Washington, DC. Waddy. SL, Merritt, VA, Hamilton-Gibson, MN, and Aiken, DE (2010) Effect of emamectin benzoate on the molt cycle of ovigerous American lobsters Homarus americanus is influenced by the dosing regimen. Aquatic Biol., 11:47-52. Wamhoff, H. and Schneider, V. (1999) Photodegradation of imidacloprid. Jour. Agric. Food Chem., 47(4):1730-1734. Westwood, F., Bean, K., Dewar, A., Bromilow, R., and Chamberlain, K. (1998) Movement and 14 persistence of [C] imidacloprid in sugar-beet plants following application to pelleted sugar-beet seed. Pesti. Sci., 52(2):97-103. Willis, KJ and Ling, N. (2003) The toxicity of emamectin benzoate, an aquaculture pesticide, to planktonic marine copepods. Aquaculture, 221:289-297. Zang, Y., et al. (2000) Genotoxicity of two novel pesticides for the earthworm, Eisenia foetida. Environ. Pollut., 108:271-278. PacketPageNumber31of194 Attachment 3 [[[IQIVEPHEWLFSVIVMRJS *VIUYIRXP]%WOIH5YIWXMSRW6IKEVHMRK 4SXIRXMEP7MHI)JJIGXWSJ7]WXIQMG-RWIGXMGMHIW 9WIH8S'SRXVSP)QIVEPH%WL&SVIV .IJJVI],ELR%WWMWXERX)\XIRWMSR)RXSQSPSKMWX(ITEVXQIRXSJ)RXSQSPSK]9RMZIVWMX]SJ1MRRIWSXE (ERMIP%,IVQW4VSJIWWSV(ITEVXQIRXSJ)RXSQSPSK]3LMS%KVMGYPXYVEP6IWIEVGLERH(IZIPSTQIRX'IRXIV8LI3LMS7XEXI9RMZIVWMX] (IFSVEL+1G'YPPSYKL4VSJIWWSV(ITEVXQIRXSJ)RXSQSPSK]ERH(ITEVXQIRXSJ*SVIWXV]1MGLMKER7XEXI9RMZIVWMX] ;LEXW]WXIQMGMRWIGXMGMHIWEVI GSQQSRP]YWIHXSTVSXIGXEWLXVIIW JVSQIQIVEPHEWLFSVIV )%& # 7]WXIQMGMRWIGXMGMHIWGSRXEMRMRKXLIEGXMZI MRKVIHMIRXWMQMHEGPSTVMHHMRSXIJYVERSVIQEQIGXMR FIR^SEXIEVIGSQQSRP]YWIHXSTVSXIGXEWLXVIIW JVSQ)%&%PPXLVIIEVIVIKMWXIVIHJSVEKVMGYPXYVEP YWIERHLEZIFIIRHIWMKREXIHF]XLI)RZMVSRQIRXEP 8LIMRZEWMZIIQIVEPHEWLFSVIVLEWOMPPIHQMPPMSRW 4VSXIGXMSR%KIRG]EW6IHYGIH6MWOMRWIGXMGMHIW SJEWLXVIIWMR2SVXL%QIVMGE JSVGIVXEMRYWIWSRJSSHGVSTW8LIQSWX[MHIP] HMVIGXP]XSXLIWYVJEGISJXLIWSMPSVMRNIGXIHEJI[ YWIHMRWIGXMGMHIMRXLI[SVPHMQMHEGPSTVMHLEW MRGLIWYRHIVXLIWSMPWYVJEGI(MRSXIJYVERGEREPWS FIIRYXMPM^IHJSVQER]]IEVWXSGSRXVSPTIWXWSJ EKVMGYPXYVEPGVSTWXYVJKVEWWERHPERHWGETITPERXW &IGEYWISJMXWPS[XS\MGMX]XSQEQQEPWMXMWEPWS JSVQYPEXMSRWSJMQMHEGPSTVMHEVIMRNIGXIHHMVIGXP]MRXS XLIFEWISJXLIXVIIXVYRO7]WXIQMGMRWIGXMGMHIWEVI MWEVIPEXMZIP]RI[TVSHYGXXLEXLEWTVSTIVXMIW XVERWTSVXIH[MXLMRXLIZEWGYPEVW]WXIQSJXLIXVII WMQMPEVXSXLSWISJMQMHEGPSTVMHFYXMXLEWRSXFIIR JVSQXLIVSSXWERHXVYROXSXLIFVERGLIWERHPIEZIW VIWIEVGLIHEWXLSVSYKLP])QEQIGXMRFIR^SEXI 8LMWVIHYGIWLE^EVHWWYGLEWHVMJXSJTIWXMGMHIXS HIVMZIHJVSQEREXYVEPP]SGGYVVMRKWSMPFEGXIVMYQ RSRXEVKIXWMXIWERHETTPMGEXSVI\TSWYVIXLEXGERFI LEWFIIRVIKMWXIVIHJSVQSVIXLER]IEVWEWE EWWSGMEXIH[MXLWTVE]MRKXVIIW[MXLFVSEHWTIGXVYQ JSPMEVWTVE]XSGSRXVSPTIWXWMRZIKIXEFPIERHGSXXSR MRWIGXWERHSXLIVRSRXEVKIXSVKERMWQW1ER] 7MQMPEVTVSHYGXWEVIYWIHMRZIXIVMREV]QIHMGMRIEW TVSHYGXWVIKMWXIVIHJSVGSRXVSPSJ)%&GERFIETTPMIH [SVQIVWJSVHSKWLSVWIWERHSXLIVERMQEPW SRP]F]PMGIRWIHETTPMGEXSVW-REPPGEWIWXLIPE[ 8SGSRXVSP)%&WSQITVSHYGXWGSRXEMRMRK VIUYMVIWXLEXER]FSH]ETTP]MRKTIWXMGMHIWGSQTP] MQMHEGPSTVMHSVHMRSXIJYVEREVIETTPMIHEWEHVIRGL [MXLMRWXVYGXMSRWERHVIWXVMGXMSRWSRXLIPEFIP %WLXVIIWPMRMRKEWXVIIXFIJSVI PIJX ERHEJXIV VMKLX XLI][IVIHIGMQEXIHF])%& PacketPageNumber32of194 Attachment 3 SVKERMGQEXXIVWMPXERHGPE][LMGLVIWXVMGXWXLIMV QSZIQIRXMRWSMP8LI]WLSYPHRSXFIETTPMIHXS TSVSYWWERH]WSMPWPEGOMRKSVKERMGQEXXIVIWTIGMEPP] [LIVIXLI[EXIVXEFPIMWWLEPPS[SV[LIRLIEZ]VEMR MWTVIHMGXIH[MXLMRXLIRI\XLSYVW 8STVSXIGXWYVJEGI[EXIVW]WXIQMGMRWIGXMGMHIW WLSYPHRSXFIETTPMIHXSWSMPRIEVTSRHWPEOIW SVWXVIEQW7SMPHVIRGLIWWLSYPHRSXFIETTPMIH XSWPSTIHWYVJEGIWJVSQ[LMGLVYRSJJGERSGGYV RSVWLSYPHTIWXMGMHIWFIQMWETTPMIHGEVIPIWWP]XS MQTIVZMSYWWYVJEGIWWYGLEWWMHI[EPOWSVWXVIIXWSV SXLIV[MWIEPPS[IHXSVIEGLGSRHYMXWXSWYVJEGI[EXIV WYGLEWHVEMRWHMXGLIWSVKYXXIVW 8S\MGSPSK]2IX[SVO4IWXMGMHI-RJSVQEXMSRGSRGPYHIH 4VIGEYXMSRWWLSYPHFIXEOIRXSTVIZIRXTIWXMGMHIWJVSQVIEGLMRK XLIVIMWKIRIVEPP]RSXELMKLVMWOSJKVSYRH[EXIV WYVJEGISVKVSYRH[EXIV GSRXEQMREXMSR[LIRTVSHYGXWEVIYWIHEWHMVIGXIH ERHETTVSTVMEXITVIGEYXMSRWEVIXEOIR7MQMPEVP]XLI ;MPPW]WXIQMGMRWIGXMGMHIWETTPMIH 'EREHMER;EXIV5YEPMX]+YMHIPMRIWJSVXLI4VSXIGXMSR XSXLIWSMPMQTEGXKVSYRHSVWYVJEGI SJ%UYEXMG0MJIRSXIHXLEX[LIRMQMHEGPSTVMHMWYWIH [EXIVUYEPMX]# GSVVIGXP]MXHSIWRSXGLEVEGXIVMWXMGEPP]PIEGLMRXS 7IZIVEPWYVZI]WLEZIFIIRGSRHYGXIHMRXLI9RMXIH HIITIVWSMPPE]IVW 7XEXIWERH'EREHEXSQSRMXSVMQMHEGPSTVMHMR ;MPPXLIWIMRWIGXMGMHIWMQTEGXEUYEXMG WYVJEGIERHKVSYRH[EXIV6IWYPXWMRHMGEXIXLEX MQMHEGPSTVMHMWVEVIP]HIXIGXIHMRWYVJEGI[EXIVSVKERMWQW# MREKVMGYPXYVEPSVYVFEREVIEW7MQMPEVQSRMXSVMRK 8LIXS\MGMX]SJMQMHEGPSTVMHXSEUYEXMGPMJIZEVMIW WXYHMIWLEZIRSXFIIRGSRHYGXIH[MXLHMRSXIJYVER [LMGLMWQSVIWSPYFPIMR[EXIV-RXLITVIWIRGISJ EQTLMFMERWERHWSQIEUYEXMGMRZIVXIFVEXIWWYGL WYRPMKLXMQMHEGPSTVMHERHHMRSXIJYVEREVIZIV] EW(ETLRME WQEPPEUYEXMGGVYWXEGIERW FYXLMKL YRWXEFPIMR[EXIVERHHIKVEHIVETMHP][LMGL XS\MGMX]XSSXLIVMRZIVXIFVEXIWWYGLEWQ]WMHWLVMQT VIHYGIWXLIMVIRZMVSRQIRXEPVMWOXSWYVJEGI[EXIV EWEPX[EXIVWTIGMIW ERHPEVZEISJWSQIEUYEXMG ;LIRRSXI\TSWIHXSPMKLXMQMHEGPSTVMHERH (MRSXIJYVERMWRSXEWXLSVSYKLP]VIWIEVGLIHFYX HMRSXIJYVERFVIEOHS[RWPS[P]MR[EXIVERHXLYW LEZIXLITSXIRXMEPXSTIVWMWXMRKVSYRH[EXIVJSV I\XIRHIHTIVMSHW-RWYVZI]WSJKVSYRH[EXIV PS[[LMPIQ]WMHWLVMQTEVIWIRWMXMZI%WTVIZMSYWP] MQMHEGPSTVMH[EWYWYEPP]RSXHIXIGXIH;LIR RSXIHMQMHEGPSTVMHERHHMRSXIJYVEREVIFVSOIR HIXIGXIHMX[EWTVIWIRXEXZIV]PS[PIZIPWQSWXP] HS[RVETMHP]MR[EXIV[LIRI\TSWIHXSPMKLX-RXLI EXGSRGIRXVEXMSRWPIWWXLERTEVXTIVFMPPMSR TTF VEVISGGEWMSRW[LIRMQMHEGPSTVMHLEWFIIRHIXIGXIH [MXLEQE\MQYQSJTTF[LMGLEVIFIPS[PIZIPW MRWYVJEGI[EXIVXLIPIZIPW[IVIXSSPS[ PIWWXLER SJGSRGIVRJSVLYQERLIEPXL8LIHIXIGXMSRWLEZI TTF XSMQTEGXIZIRWIRWMXMZIEUYEXMGSVKERMWQW KIRIVEPP]SGGYVVIHMREVIEW[MXLTSVSYWVSGO]SV WERH]WSMPW[MXLPMXXPISVKERMGQEXXIV[LIVIXLIVMWO -QMHEGPSTVMHWSMPMRNIGXMSRWLEZIFIIR[MHIP]YWIHMR SJPIEGLMRKMWLMKL{ERHSV[LIVIXLI[EXIVXEFPI VEZMRIWSJ7QSO]1SYRXEMR2EXMSREP4EVOERHSXLIV [EWGPSWIXSXLIWYVJEGI JSVIWXIHEVIEWXSGSRXVSPLIQPSGO[SSPP]EHIPKMH ERMRZEWMZIMRWIGXXLEXMWHIZEWXEXMRKLIQPSGOXVIIW )ZIV]TVIGEYXMSRWLSYPHFIXEOIRXSTVSXIGXWYVJEGI MRXLI%TTEPEGLMER1SYRXEMRW%VMWOEWWIWWQIRX ERHKVSYRH[EXIVJVSQTIWXMGMHIGSRXEQMREXMSR TVITEVIHJSVXLI97(%*SVIWX7IVZMGI w-QMHEGPSTVMH 8VYROMRNIGXIHMRWIGXMGMHIWTSWIPMXXPIVMWOXSKVSYRH {,YQER,IEPXLERH)GSPSKMGEP6MWO%WWIWWQIRXx ERHWYVJEGI[EXIV[LIRYWIHEWHMVIGXIHFIGEYWI GSRGPYHIHXLEXXLIWIXVIEXQIRXWTSWIRIKPMKMFPI XLIQEXIVMEPMWTPEGIHMRWMHIXLIXVII VMWOXSEUYEXMGSVKERMWQW[LIRETTPMIHEWHMVIGXIH 8STVSXIGXKVSYRH[EXIVWSMPETTPMGEXMSRWSJW]WXIQMG XSGPE]SVPSEQWSMPWERHXLEXIZIRE[SVWXGEWI MRWIGXMGMHIWWLSYPHFIQEHIMQQIHMEXIP]EHNEGIRX WGIREVMSSJEQENSVWTMPPSJMQMHEGPSTVMHMRXSE XSXLIXVYROSJXLIXVII[LMGLMRGVIEWIWYTXEOI ERH EQTLMFMERWSVXSPIVERXEUYEXMGMRZIVXIFVEXIW;LIR YWIHEWHMVIGXIHMQMHEGPSTVMHWSMPXVIEXQIRXWJSV 7]WXIQMGMRWIGXMGMHIWFMRHXSZEV]MRKHIKVIIWXS )%&GSRXVSPEVIYRPMOIP]XSMQTEGXEUYEXMGSVKERMWQW PacketPageNumber33of194 Attachment 3 ;LEXEFSYXMRWIGXMGMHIVIWMHYIWMR WIRIWGIHPIEZIWXLEXJEPPJVSQXVIIW MREYXYQR# 8LMWUYIWXMSRLEWRSXFIIRXLSVSYKLP]VIWIEVGLIH 3RIWXYH]GSRHYGXIHMRI\TIVMQIRXEPQMGVSGSWQW JSYRHXLEXMQMHEGPSTVMHVIWMHYIWMRWIRIWGIH HIEH PIEZIWJVSQXVIEXIHXVIIWLEHRSIJJIGXSR QMGVSFMEPVIWTMVEXMSRSVHIGSQTSWMXMSRSVWYVZMZEP SJPIEJWLVIHHMRKMRWIGXWXLEXHIGSQTSWIHIEH ZIKIXEXMSR-RWIGXJIIHMRKVEXIW[IVIHIGVIEWIH F]MQMHEGPSTVMHGSRGIRXVEXMSRWSJTEVXWTIV QMPPMSR TTQ [LMPIPS[IVGSRGIRXVEXMSRW TTQ LEHRSIJJIGX;LIRPIEJWLVIHHMRKMRWIGXW SVIEVXL[SVQW[IVIKMZIRWIRIWGIHQETPIPIEZIW ,SRI]FIIWERHSXLIVTSPPMREXSVWGERFILEVQIHF]MRWIGXMGMHIW [MXLLMKLIVGSRGIRXVEXMSRWSJMQMHEGPSTVMH TTQ XLIMVJIIHMRKVEXIW[IVIVIHYGIHFYXXLIMV WYVZMZEP[EWRSXEJJIGXIH-RERSXLIVQMGVSGSWQ EVIXVERWPSGEXIHXSRIGXEVERHTSPPIR-QMHEGPSTVMH WXYH]MQMHEGPSTVMHMRLMFMXIHFVIEOHS[RSJPIEJPMXXIV MWJEXEPXSLSRI]FIIW[LIRMXVIEGLIWLMKLIRSYKL FYXJSPMEVGSRGIRXVEXMSRWMRXLMWWXYH] TTQ GSRGIRXVEXMSRWERHGERLEZILEVQJYPWYFPIXLEP JVIWL[IMKLX [IVIQSVIXLERERSVHIVSJQEKRMXYHI IJJIGXWEXPS[IVGSRGIRXVEXMSRW LMKLIVXLERXLSWIVITSVXIHMRPIEZIWJVSQXVIIW XVIEXIHJSV)%&GSRXVSP-REPPSJXLIWII\TIVMQIRXW 8LIVILEWFIIRQYGLGSRGIVRVIGIRXP]EFSYX SVKERMWQW[IVII\TSWIHSRP]XSPIEZIWJVSQXVIEXIH XLITSXIRXMEPVSPISJMQMHEGPSTVMHERHVIPEXIH XVIIW-RQER]WMXYEXMSRWPIEZIWJVSQXVIEXIHEWL RISRMGSXMRSMHMRWIGXMGMHIWMRGSPSR]GSPPETWIHMWSVHIV XVIIW[SYPHFIQM\IH[MXLWIRIWGIHPIEZIWSJSXLIV ''( 6IWIEVGLMWSRKSMRKXSMRZIWXMKEXIXLIVIPEXMZI WTIGMIWKVS[MRKRIEVF] IJJIGXWSJTIWXMGMHIWFIITEXLSKIRWERHTEVEWMXIW ERHRYXVMXMSRSRLSRI]FIILIEPXL8SHEXIXLIVIEVI 7MQMPEVWXYHMIWLEZIRSXFIIRGSRHYGXIH[MXL RSGSRGPYWMZIERW[IVWFYXVIWIEVGLIVWLEZIRSX IQEQIGXMRFIR^SEXI[LMGLMWFVSOIRHS[RVETMHP] FIIREFPIXSIWXEFPMWLEPMROFIX[IIRMQMHEGPSTVMH F]QMGVSFMEPEGXMZMX]ERHWYRPMKLX&IGEYWISJMXW ERH''(7XVSRKIVIZMHIRGIMQTPMGEXIWE WLSVXVIWMHYEPEGXMZMX]SRXLIWYVJEGISJPIEZIWMXMW GSQFMREXMSRSJTEXLSKIRWEW[IPPEWSXLIVTIWXMGMHIW GSRWMHIVIHEFMSVEXMSREPMRWIGXMGMHIGSQTEXMFPI[MXL MRXIKVEXIHTIWXQEREKIQIRXTVSKVEQWMRGPYHMRK FMSPSKMGEPGSRXVSP8LIWIGLEVEGXIVMWXMGWWYKKIWX ;MPPXLIWIMRWIGXMGMHIWLEVQSXLIV XLEXIRZMVSRQIRXEPMQTEGXW[MPPFIRIKPMKMFPIEW MRWIGXW# IQEQIGXMRFIR^SEXIMWVIPIEWIHJVSQHIGSQTSWMRK PIEZIW6IKYPEXSV]EKIRGMIWGSRGPYHIHXLEXJSPMEV %PPSJXLIW]WXIQMGMRWIGXMGMHIWYWIHXSGSRXVSP)%& ETTPMGEXMSRWSJIQEQIGXMRFIR^SEXIXSZIKIXEFPI [MPPMQTEGXSXLIVWTIGMIWSJMRWIGXWXLEXJIIHSR GVSTW[MPPLEZIRSEHZIVWIIJJIGXWSRKVSYRHSV XVIEXIHEWLXVIIW,S[IZIVEWLXVIIWXLEXEVIRSX XVIEXIH[MPPFIOMPPIHF])%&[LMGL[MPPEPWSMQTEGX MRZIVXIFVEXIW[LIRYWIHEWHMVIGXIH XLIWIMRWIGXW7SQITVSHYGXWGEREJJIGXQER]OMRHW SJMRWIGXW[LMPISXLIVWEJJIGXSRP]GIVXEMRKVSYTW ;MPPXLIWIMRWIGXMGMHIWLEVQLSRI] SJMRWIGXW*SVI\EQTPIIQEQIGXMRFIR^SEXILEW FIIW# FIIRWLS[RXSEJJIGXEFVSEHVERKISJTPERXJIIHMRK MRWIGXW4VSHYGXW[MXLMQMHEGPSTVMHKIRIVEPP]LEZI %WLXVIIWEVI[MRHTSPPMREXIHERHEVIRSXERIGXEV PMXXPIIJJIGXSRGEXIVTMPPEVWQMXIWERHEVQSVIH TVSHYGIHIEVP]MRXLIKVS[MRKWIEWSRERHEVI FIIXPIWERHWETJIIHMRKMRWIGXWWYGLEWETLMHWERH TVIWIRXJSVSRP]EPMQMXIHRYQFIVSJHE]W-XMWLMKLP] YRPMOIP]XLEXFIIW[SYPHFII\TSWIHXSW]WXIQMG TVIHEXSVWERHTEVEWMXSMHW{WYGLEWPEH]FIIXPIW MRWIGXMGMHIWETTPMIHXSEWL PEGI[MRKWERHTEVEWMXMG[EWTW{GERFIOMPPIHF] MRHMVIGXI\TSWYVIXSMQMHEGPSTVMHXLVSYKLXLIMV *PS[IVMRKTPERXWXLEXEVITSPPMREXIHF]FIIWSV TVI]SVHMVIGXP]F]JIIHMRKSRRIGXEVJVSQXVIEXIH SXLIVMRWIGXWWLSYPHRSXFITPERXIHMQQIHMEXIP] TPERXW,S[IZIVW]WXIQMGMRWIGXMGMHIWEVIKIRIVEPP] EHNEGIRXXSEWLSVSXLIVXVIIWXLEX[MPPFIXVIEXIH GSRWMHIVIHXSLEZIPIWWMQTEGXSRREXYVEPIRIQMIW [MXLW]WXIQMGMRWIGXMGMHIWETTPMIHXSXLIWSMPEWXLI] XLERFVSEHWTIGXVYQMRWIGXMGMHIWETTPMIHEWJSPMEVSV QE]EPWSEFWSVFMRWIGXMGMHI,SRI]FIIWERHSXLIV GSZIVWTVE]W MRWIGXWGERFIEJJIGXIH[LIRW]WXIQMGMRWIGXMGMHIW PacketPageNumber34of194 Attachment 3 XLIMRNYV]EWWSGMEXIH[MXLHVMPPMRKLSPIWERHMRNIGXMRK X[SMRWIGXMGMHITVSHYGXW -QMGMHIETTPMIH[MXL 1EYKIXGETWYPIWERH86))EKI}ETTPMIH[MXLXLI %VFSVNIX8VII-:}ERH5YMGONIX} MRXSXVYROWSJEWL XVIIW[EWI\EQMRIH-RRIEVP]EPPGEWIWEWLXVIIW XLEX[IVIVIPEXMZIP]LIEPXL]ERHTVSTIVP]MRNIGXIH WLS[IHPMXXPIIZMHIRGISJHEQEKI2I[LIEPXL] [SSH[EWTVSHYGIHSZIVXLIMRNIGXMSRWMXIWERH XLIVI[EWRSIZMHIRGISJTEXLSKIRMRJIGXMSRHIGE] SVSXLIVWMKRWSJWIVMSYWMRNYV]3XLIVHIZMGIWYWIH XSMRNIGXEWLXVIIWKIRIVEXI[SYRHWXLEXHMJJIVJVSQ XLSWIGEYWIHF]HVMPPMRKHMWGVIXILSPIWMRXLIXVII ,S[IZIVXLIMVMQTEGXLEWRSXFIIRXLSVSYKLP] IZEPYEXIHMRVIWIEVGLTVSNIGXW;IHSORS[XLEX YRXVIEXIHEWLXVIIWMREVIEW[MXL)%&MRJIWXEXMSRW [MPPIZIRXYEPP]FIOMPPIH ;MPPXVIEXMRKEWLXVIIWVIWYPXMR ;SSHTIGOIVWEVIMQTSVXERXTVIHEXSVWSJSZIV[MRXIVMRK )%&PEVZEI HIZIPSTQIRXSJVIWMWXERGISJ)%& XSMRWIGXMGMHIW# ;MPPXLIWIMRWIGXMGMHIWLEVQ [SSHTIGOIVW# 8LMWMWLMKLP]YRPMOIP]4IWXWX]TMGEPP]IZSPZI VIWMWXERGIXSTIWXMGMHIWSRP]MRWMXYEXMSRW[LIVI 8LMWMWYRPMOIP];SSHTIGOIVWJIIHSRPMZIQEXYVI ELMKLTVSTSVXMSRSJXLIMRWIGXTSTYPEXMSR[EW )%&PEVZEIQSWXP]MRPEXIJEPP[MRXIVERHIEVP] WYFNIGXIHXSWXVSRKWIPIGXMSRTVIWWYVI*SVI\EQTPI WTVMRK1ER]SJXLIWIQEXYVIPEVZEISZIV[MRXIV TIWXMGMHIVIWMWXERGILEWIZSPZIHMRMRWIGXERH[IIH MRXLIRSRPMZMRKSYXIVFEVO[LIVIXLI][MPPRSXFI I\TSWIHXSW]WXIQMGMRWIGXMGMHIW-QMHEGPSTVMH ERHKVEMRWXSVEKIFMRW[LIVIRIEVP]EPPSJXLITIWX HMRSXIJYVERERHIQEQIGXMRFIR^SEXIEVIQYGL TSTYPEXMSR[EWI\TSWIHXSXLITIWXMGMHI%WLXVIIW QSVIXS\MGXSMRWIGXWXLERXSFMVHWXLEXLEZIFIIR EVIZIV]GSQQSRMRQER]REXYVEPIRZMVSRQIRXW XIWXIHERHMRWIGXMGMHIGSRGIRXVEXMSRWXLEXLEZI 0ERHWGETIXVIIWVITVIWIRXEWQEPPJVEGXMSRSJEPP FIIRQIEWYVIHMRXVIEXIHXVIIWEVIJEVFIPS[XLI XLIEWLXLEX[MPPFIGSPSRM^IHF])%&MREKMZIR PIZIPWORS[RXSFIXS\MGXSFMVHW%R)%&PEVZE EVIEERHSRP]EWQEPPTVSTSVXMSRSJLMKLZEPYI XLEXLEWFIIROMPPIHF]MRWIGXMGMHI[MPPHIWMGGEXI XVIIW[MPPIZIVFIXVIEXIHXSGSRXVSP)%&8LYW UYMGOP]ERHHIGSQTSWI8LIVIMWPMXXPIIZMHIRGI QSWXSJXLI)%&TSTYPEXMSR[MPPRIZIVFII\TSWIH XLEX[SSHTIGOIVW[MPPJIIHSRPEVZEPGEHEZIVW XSMRWIGXMGMHIW&IGEYWIXLIWIPIGXMSRTVIWWYVIMW *YVXLIVQSVIPMZMRKPEVZEIXLEXEVIWYMXEFPITVI] WSPS[ERHXLIVI[MPPFITPIRX]SJGVSWWFVIIHMRK JSV[SSHTIGOIVW[MPPRSXLEZIFIIRI\TSWIHXSE [MXLMRHMZMHYEPWXLEXLEZIRIZIVFIIRI\TSWIHXS PIXLEPHSWISJMRWIGXMGMHIERHXLIWITVSHYGXWHSRSX MRWIGXMGMHIWXLIVMWOSJEVIWMWXERX)%&TSTYPEXMSR FMSEGGYQYPEXIMRERMQEPWMRXLI[E]XLEXJEXWSPYFPI IZSPZMRKMWQMRMQEP MRWIGXMGMHIWWYGLEW((8HS-R1MGLMKERERH3LMS [LIVI)%&LEWFIIRIWXEFPMWLIHJSVWIZIVEP]IEVW %GORS[PIHKIQIRXW QER]EWLXVIIWLEZIFIIRXVIEXIH[MXLW]WXIQMG MRWIGXMGMHIW8LIVILEZIFIIRRSVITSVXIHGEWIW ;IXLEROXLIJSPPS[MRKJSVXLIMVGSQQIRXWERHWYKKIWXMSRWSRE SJ[SSHTIGOIVTSMWSRMRKGEYWIHF]MRWIGXMGMHIWTVIZMSYWHVEJXSJXLMWFYPPIXMR2MPE,MRIW 1MRRIWSXE(ITEVXQIRX SJ%KVMGYPXYVI (ERMIP/IRR] 3LMS(ITEVXQIRXSJ%KVMGYPXYVI ETTPMIHJSVGSRXVSPSJ)%& 7XIZIR/EXSZMGL 97(%*SVIWX7IVZMGI :IVE/VMWGLMO 9RMZIVWMX] SJ1MRRIWSXE 4LMPPMT0I[MW 97(%%RMQEPERH4PERX,IEPXL (SIWMRNIGXMRKMRWIGXMGMHIWMRXS -RWTIGXMSR7IVZMGI 'EXLIVMRI0MRHIPP 1MGLMKER7XEXI9RMZIVWMX] 8LIVIWI4SPERH 97(%*SVIWX7IVZMGI (ERMIP4SXXIV 9RMZIVWMX] XVYROWMRNYVIXLIXVIIW# SJ/IRXYGO] 1MGLEIP6EYTT 9RMZIVWMX]SJ1EV]PERH 4EYPE 7LVI[WFYV] 9RMZIVWMX]SJ1EV]PERH 1EVPE7TMZEO 9RMZIVWMX] (VMPPMRKXLVSYKLXLISYXIVFEVOGVIEXIWE[SYRHMR SJ1MRRIWSXE .EQIW8I[ 8LI3LMS7XEXI9RMZIVWMX] )PPMSX XLIXVII8LIVIWTSRWISJXLIXVIIXSXLIWI[SYRHW 8VEQIV 9RMZIVWMX]SJ8SPIHS ERH.SWITL>EGLQERR 1MRRIWSXE MWEJJIGXIHF]JEGXSVWWYGLEWXLIWM^IERHHITXLSJ (ITEVXQIRXSJ%KVMGYPXYVI 6IWTSRWMFMPMX]JSVXLIGSRXIRXSJXLMW XLILSPIERHXLIZMKSVSJXLIXVII-RVIGIRXWXYHMIW HSGYQIRXVIWXW[MXLXLIEYXLSVW -RJSVQEXMSRTVSZMHIHLIVIMWJSVIHYGEXMSREPTYVTSWIWSRP]6IJIVIRGIWXSGSQQIVGMEPTVSHYGXWSVXVEHIREQIWHSRSXMQTP]IRHSVWIQIRXF]XLIEYXLSVWSVXLIMVMRWXMXYXMSRW 8LI9RMZIVWMX]SJ1MRRIWSXE)\XIRWMSRMWERIUYEPSTTSVXYRMX]IHYGEXSVERHIQTPS]IV-REGGSVHERGI[MXLXLI%QIVMGERW[MXL(MWEFMPMXMIW%GXXLMWTYFPMGEXMSRQEXIVMEPMWEZEMPEFPI MREPXIVREXMZIJSVQEXWYTSRHMVIGXVIUYIWXXSXLI9RMZIVWMX]SJ1MRRIWSXE)\XIRWMSR7XSVIEX 3LMS7XEXI9RMZIVWMX])\XIRWMSRIQFVEGIWLYQERHMZIVWMX]ERHMWGSQQMXXIHXSIRWYVMRKXLEXEPPVIWIEVGLERHVIPEXIHIHYGEXMSREPTVSKVEQWEVIEZEMPEFPIXSGPMIRXIPISRE RSRHMWGVMQMREXSV]FEWMW[MXLSYXVIKEVHXSVEGIGSPSVVIPMKMSRWI\EKIREXMSREPSVMKMRWI\YEPSVMIRXEXMSRKIRHIVMHIRXMX]SVI\TVIWWMSRHMWEFMPMX]SVZIXIVERWXEXYW8LMW WXEXIQIRXMWMREGGSVHERGI[MXL9RMXIH7XEXIW'MZMP6MKLXW0E[WERHXLI97(%/IMXL07QMXL4L(%WWSGMEXI:MGI4VIWMHIRXJSV%KVMGYPXYVEP%HQMRMWXVEXMSRERH(MVIGXSV3LMS 7XEXI9RMZIVWMX])\XIRWMSR8((2S 3LMSSRP] SV SVMKMRKIRHIVKIRHIVMHIRXMX]VIPMKMSREKILIMKLX[IMKLXHMWEFMPMX]TSPMXMGEPFIPMIJWWI\YEPSVMIRXEXMSRQEVMXEPWXEXYWJEQMP]WXEXYWSVZIXIVERWXEXYW-WWYIHMRJYVXLIVERGISJ PacketPageNumber35of194 179)\XIRWMSR[SVOEGXWSJ1E]ERH.YRIMRGSSTIVEXMSR[MXLXLI97(ITEVXQIRXSJ%KVMGYPXYVI8LSQEW+'SSR(MVIGXSV179)\XIRWMSR)EWX0ERWMRK1- *IFVYEV] THIS PAGE IS INTENTIONALLY LEFT BLANK PacketPageNumber36of194 AGENDA REPORT TO FROM: SUBJECT:Capital Improvement Plan – Review of Draft Report DATE:April 20, 2011 INTRODUCTION Background Information Capital Improvement Plan Process PacketPageNumber37of194 Summary of CIP 1.New annual revenue for Public Safety Facilities: $620,000 New Fire Stations New money to the Fire Truck Replacement Fund Police Department Expansion beginning in 2011 - 2012 Begin to reduce the Deficit in the Ambulance Fund PacketPageNumber38of194 Fire Training Facility / Marshlands Proposal Rehabilitation of Fire Station #2 New Police Facility PacketPageNumber39of194 Public Safety Program Cuts [to be reviewed in June – July] Additional Funds to cover Debt Service $250,000 Support for the Debt Service Fund on Previous Projects Continued investment in the Streets Program Public Works Program Cuts [to be reviewed in June – July] Additional Funds for Operating and Facility Expenses $460,000 Support for new Operating Expenses in 2012 PacketPageNumber40of194 New Capital for Improvements at MCC New Funds for CIP Fund for Facilities Additional identified needs at Maplewood Community Center Additional Funds for Park Development PacketPageNumber41of194 General Fund Program Cuts [to be reviewed in June – July] Budgetary Consideration Recommended Action PacketPageNumber42of194 Attachment 1 Carsgrove Meadows Area Improvements Hills and Dales Joy Park Shoreline PacketPageNumber43of194 Attachment 1 TABLE OF CONTENTS Principal City Officials .......................................................................................................................... 1 City Manager's Letter of Transmittal .................................................................................................... 2 Highlights .............................................................................................................................................. 6 New Projects ......................................................................................................................................... 7 Projects by Category ............................................................................................................................. 8 Schedule for Construction and Financing of 2012 Projects ................................................................ 10 Schedule for 2012 Bond Issue ............................................................................................................. 11 Projects by Category for 2012 ............................................................................................................. 12 Projects Scheduled for 2012 ................................................................................................................ 13 Funding Sources for the Capital Improvement Plan ........................................................................... 15 General Community Development Information ................................................................................. 19 Undeveloped Land Map ...................................................................................................................... 20 Maplewood Population Statistics ........................................................................................................ 21 Debt Capacity ..................................................................................................................................... 25 Debt Transactions Past Five Years and Next Five Years .................................................................... 26 C.I.P. Impact on City Debt .................................................................................................................. 27 Debt Per Capita ................................................................................................................................... 28 Debt to Market Value ......................................................................................................................... 30 Legal Debt Margin .............................................................................................................................. 32 Capital Improvement Plan Financing Strategy .................................................................................... 33 Impact on Property Taxes .................................................................................................................... 34 Project Details ..................................................................................................................................... 35 Map of City by Neighborhood ......................................................................................................... 37 Western Hills – Neighborhood #1 Map Legend and Population Data .................................................................................................... 38 Neighborhood Map .......................................................................................................................... 39 Parkside – Neighborhood #2 Map Legend and Population Data .................................................................................................... 40 Neighborhood Map .......................................................................................................................... 41 Arkwright/Sunrise Area Streets ........................................................................................................ 43 Kohlman Lake – Neighborhood #3 Map Legend and Population Data .................................................................................................... 44 Neighborhood Map .......................................................................................................................... 45 Hazelwood – Neighborhood #4 Map Legend and Population Data .................................................................................................... 46 Neighborhood Map .......................................................................................................................... 47 Legacy Park Improvements .............................................................................................................. 49 PacketPageNumber44of194 Attachment 1 TABLE OF CONTENTS Maplewood Heights – Neighborhood #5 Map Legend and Population Data .................................................................................................... 50 Neighborhood Map .......................................................................................................................... 51 Sherwood Glen – Neighborhood #6 Map Legend and Population Data .................................................................................................... 52 Neighborhood Map .......................................................................................................................... 53 Police Department Expansion .......................................................................................................... 55 Maplewood Community Center Improvements ............................................................................... 56 TH 36 – English Intersection Improvements ................................................................................... 57 Gladstone – Neighborhood #7 Map Legend and Population Data .................................................................................................... 58 Neighborhood Map .......................................................................................................................... 59 Gladstone Area Streetscape – Phase I .............................................................................................. 61 Gladstone – Phase II ........................................................................................................................ 62 Gladstone Savanna Improvements ................................................................................................... 63 Hillside – Neighborhood #8 Map Legend and Population Data .................................................................................................... 64 Neighborhood Map .......................................................................................................................... 65 Goodrich Park Improvements .......................................................................................................... 67 Beaver Lake – Neighborhood #9 Map Legend and Population Data .................................................................................................... 68 Neighborhood Map .......................................................................................................................... 69 Lions Park Improvements ................................................................................................................ 71 Gethsemane Park .............................................................................................................................. 72 City Landfill Closure ........................................................................................................................ 73 Bartelmy Meyer Area Streets ........................................................................................................... 74 Farrell/Ferndale Area Street Improvements ..................................................................................... 75 Battle Creek – Neighborhood #10 Map Legend and Population Data .................................................................................................... 76 Neighborhood Map .......................................................................................................................... 77 Dennis/McClelland Area Street Improvements ................................................................................ 79 Vista Hills – Neighborhood #11 Map Legend and Population Data .................................................................................................... 80 Neighborhood Map .......................................................................................................................... 81 Crestview/Highwood Area Streets ................................................................................................... 83 Highwood – Neighborhood #12 Map Legend and Population Data .................................................................................................... 84 Neighborhood Map .......................................................................................................................... 85 Fish Creek Open Space .................................................................................................................... 86 Lakewood/Sterling Area Streets ....................................................................................................... 87 Carver Ridge – Neighborhood #13 Map Legend and Population Data .................................................................................................... 88 Neighborhood Map .......................................................................................................................... 89 Sterling Street Bridge Replacement ................................................................................................. 91 PacketPageNumber45of194 Attachment 1 TABLE OF CONTENTS Projects without a Neighborhood Designation .................................................................................... 92 Replacement of Fire Truck ............................................................................................................... 93 Replacement of Fire Truck ............................................................................................................... 94 Ambulance Replacement ................................................................................................................. 95 Ambulance Replacement ................................................................................................................. 96 Replacement of Fire Station ............................................................................................................. 97 Replacement of Fire Station ............................................................................................................. 98 Election Equipment .......................................................................................................................... 99 Public Works Carpeting ................................................................................................................. 100 Nature Center Building Improvements .......................................................................................... 101 Community Field Upgrades ........................................................................................................... 102 Park Equipment, Fence and Court Replacement ............................................................................ 103 Open Space Improvements ............................................................................................................ 104 Lift Station Upgrade Program ........................................................................................................ 105 Two Toro Lawn Mowers and Two Trailers ................................................................................... 106 One Tractor Loader and Three Wheel Truckster ........................................................................... 107 One Snow Plow Truck ................................................................................................................... 108 1-Ton Truck ................................................................................................................................... 109 Two Jacobsen Lawn Mowers ......................................................................................................... 110 Two Toro Lawn Mowers and One 4 Wheel Truckster .................................................................. 111 Two 1 Ton Trucks and One ½ Ton Trucks .................................................................................... 112 Jetter Truck .................................................................................................................................... 113 Parallelogram Lift .......................................................................................................................... 114 Single Axle Plow Truck ................................................................................................................. 115 Emergency Generator..................................................................................................................... 116 Mill and Overlays ........................................................................................................................... 117 MT-Trackless Maintenance Vehicle .............................................................................................. 118 Two ½ Ton Pickups ....................................................................................................................... 119 One Ton Truck ............................................................................................................................... 120 Crack Router .................................................................................................................................. 121 Grounds Sweeper ........................................................................................................................... 122 Project Listings: Grouped by Department ................................................................................................................. 123 Grouped by Funding Source .......................................................................................................... 125 Grouped by Project Category ......................................................................................................... 129 Grouped by Neighborhood............................................................................................................. 130 Grouped by Department – Declined .............................................................................................. 132 Projects Deferred/Declined ............................................................................................................ 133 Financial Projections for Capital Project Funds and Fleet Management Fund: Ambulance Service Fund ............................................................................................................... 134 Capital Improvement Projects Fund ............................................................................................... 135 PacketPageNumber46of194 Attachment 1 TABLE OF CONTENTS Community Center Operation Funds ............................................................................................. 136 Environmental Utility Fund ........................................................................................................... 137 Fire Truck Replacement Fund ........................................................................................................ 138 Fleet Management Fund ................................................................................................................. 139 Park Development Fund ................................................................................................................. 140 Sanitary Sewer Fund ...................................................................................................................... 141 Street Light Utility Fund ................................................................................................................ 142 Water Availability Charge Fund-St. Paul Water District ............................................................... 143 PacketPageNumber47of194 Attachment 1 INTRODUCTION PacketPageNumber48of194 Attachment 1 CITY OF MAPLEWOOD, MINNESOTA PRINCIPAL CITY OFFICIALS PacketPageNumber49of194 1 Attachment 1 PacketPageNumber50of194 2 Attachment 1 PacketPageNumber51of194 3 Attachment 1 PacketPageNumber52of194 4 Attachment 1 PacketPageNumber53of194 5 Attachment 1 HIGHLIGHTS OF THE CAPITAL IMPROVEMENT PLAN 2010-20142011-20152012-2016Increase(Decrease) C.I.PC.I.PC.I.PAmountPercent Buildings Redevelopment Equipment Parks Public Works TOTALS The five largest projects within the C.I.P. are as follows: 1. TH 36 - English Intersection Improvements - $14,000,000 2. Crestview/Highwood Area Streets - $7,350,000 3. Gladstone Area Streetscape Phase I - $6,000,000 4. Arkwright/Sunrise Area Streets - $4,480,000 5. Dennis/McClelland Area Streets - $4,250,000 PacketPageNumber54of194 6 Attachment 1 NEW PROJECTS IN THE CAPITAL IMPROVEMENT PLAN PacketPageNumber55of194 7 Attachment 1 PROJECTS BY CATEGORYPROJECTS BY CATEGORY 2012-20162012-2016 PacketPageNumber56of194 8 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS BY PROJECT CATEGORY PacketPageNumber57of194 9 Attachment 1 SCHEDULE FOR CONSTRUCTION AND FINANCING OF 2012 PROJECTS The Capital Improvement Plan coordinates the financing and timing of major equipment purchases and construction projects. Therefore, it is very important that the C.I.P. be followed as much as possible. This is especially important for the Public Works and Finance Departments. Public improvement projects need to be scheduled to avoid peaks and valleys in workloads. This will allow the engineering staff in the Public Works Department to provide the engineering services required and minimize the need to hire engineering consultants. A closely followed schedule for construction projects will also facilitate Finance Department planning for bond issues. The schedule that needs to be followed for construction of the public improvement projects listed in this document for 2012 is as follows: SCHEDULE FOR PUBLIC IMPROVEMENT PROJECTS TO BE CONSTRUCTED IN 2012 August 2011 Begin Neighborhood Meetings November 2011 Council receives Engineer's Report and orders Public Hearing November 2011 Publish Legal Notice December thru Public Hearings; Order Improvement and Preparation Plans and February 2012 Specifications Approve Plans and Specifications; Authorization to Advertise for February 2012 Bids March 2012 Award Bids PacketPageNumber58of194 10 Attachment 1 It is planned that bonds will be sold in May 2012 to finance the capital improvement projects that will be constructed in 2012. The schedule for the issuance of these bonds is as follows: SCHEDULE FOR 2012 BOND ISSUE Last day for City Council to order projects to be financed by the March 26, 2012 bond issue Financial data on projects to be financed due to financial consultant March 30, 2012 Resolution setting bond sale due from bond council bond sale details April 13, 2012 due from financial consultant April 23, 2012 City Council adoption of resolution authorizing bond issue Official statement (prospectus) distributed to rating agency, City, and May 14, 2012 prospective bidders May 16, 2012 Bond rating due from Standard and Poor’s. May 21, 2012 Bid opening and award of bids June 18, 2012 Bond proceeds delivered to City PacketPageNumber59of194 11 Attachment 1 PROJECTS BY CATEGORYPROJECTS BY CATEGORY 20122012 PacketPageNumber60of194 12 Attachment 1 PROJECTS SCHEDULED FOR 2012 PacketPageNumber61of194 13 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber62of194 14 Attachment 1 FUNDING SOURCES FOR THE CAPITAL IMPROVEMENT PLAN Bonds and Notes: Capital Notes – these are a form of short-term indebtedness that are backed by the full faith, credit, and taxing powers of the City of Maplewood. They are usually issued with a five-year term to finance large equipment purchases. General Obligation Bonds – G.O. bonds are backed by the full faith, credit, and taxing powers of the City of Maplewood. Within this C.I.P. document, general obligation bonds means bonds that are 100% supported by tax levies. Bonds that are more than 80% supported by tax levies require voter approval before they can be issued. General Obligation Improvement Bonds – these bonds are similar to General Obligation Bonds except they do not require voter approval for issuance. This is because they represent the portion of public improvement project costs that are not assessed. At least 20% of the project cost must be assessed to issue these bonds. Municipal State Aid Bonds – these bonds are issued to finance improvements to municipal state-aid streets. Under state law, future allotments of state street aid are pledged to pay the principal and interest on the bonds. The bonds are also backed by the full faith, credit, and taxing powers of the city.. Special Assessment Bonds – these bonds are payable from charges made to property owners who benefit from public improvements. These charges are referred to as special assessments and are billed to property owners with their property taxes. Under state law, special assessment bonds can be issued without voter approval provided that at least 20% of the improvement cost has been assessed. Special assessment bonds issued by Maplewood also are backed by the full faith, credit, and taxing powers of the city. Tax Increment Bonds – these bonds can be issued for housing, economic development (e.g., to pay for a site for a business), construction of public facilities or infrastructure, and redevelopment of blighted areas. The bonds can be revenue bonds or general obligation and are not subject to referendum approval. Ambulance Service Fund –this fund was established in 2005 to account for customer service charges that are used to finance emergency medical services. Capital Improvement Projects Fund – this fund was established to finance major capital outlay expenditures that cannot be easily financed by alternative revenue sources. Property taxes are levied annually for this fund. On the project detail pages in Section 3 this fund is referred to as the C.I.P. Fund. PacketPageNumber63of194 15 Attachment 1 Community Center Operations Fund – accounts for revenues and expenses related to the operation of the community center building and related activities. Electric Franchise Fee – the franchise agreement with Excel Energy allows the City to impose a franchise fee of not more than four percent of the company’s gross revenues. A franchise fee of $.50 per household has been imposed by the City. Environmental Utility Fund – this fund was established to finance maintenance and improvements to the storm water utility system. Revenues for the fund are generated by a utility charge for surface water runoff. Federal Aid – within this C.I.P. document this is used to identify a portion of public works improvement costs that are paid by the Federal Government. Fleet Management Fund – this fund accounts for the operating expenses of all city vehicles and major pieces of equipment (except for public safety vehicles). These operating expenses, including depreciation, are used as a basis to establish rental rates that are charged to the departments using the vehicles. The accounting procedures used in this fund result in a cash reserve for the replacement of vehicles and major pieces of equipment. On the project detail pages in Section 3 this fund is referred to as the V.E.M. Fund. Fire Truck Replacement Fund – this fund was established to finance all future purchases of fire trucks. Property taxes are levied annually as needed to provide for planned purchases. General Fund – this fund accounts for all financial resources except those required to be accounted for in another fund. The fund accounts for the majority of the City’s operating budget. Information Technology Fund – accounts for the maintenance, repair, and operation of the city’s computer hardware and software. Little Canada – within this C.I.P. document this is used to identify that portion of public works improvement costs that are paid by the City of Little Canada. When roads on the border between Maplewood and Little Canada are improved, the two governments jointly finance the cost of the improvement. MnDOT – within this C.I.P. document this is used to identify a portion of public works improvement costs that are paid by the Minnesota Department of Transportation. North St. Paul – within this C.I.P. document this is used to identify that portion of public works improvement costs that are paid by the City of North St. Paul. When roads on the border between Maplewood and North St. Paul are improved, the two governments jointly finance the cost of the improvement. Oakdale – within this C.I.P. document this is used to identify that portion of public works improvement costs that are paid by the City of Oakdale. When roads on the border between Maplewood and Oakdale are improved, the two governments jointly finance the cost of the improvement. PacketPageNumber64of194 16 Attachment 1 Open Space Land Acquisition Fund – this fund was established in 1994 with the proceeds from a bond issue. The balance left in the fund is from investment interest. Park Development Fund – this fund accounts for the receipt and disbursement of park availability charges. These charges are levied against all new buildings constructed and are paid when the building permit is issued. Money from P.A.C. on residential buildings can only be spent on park developments within the neighborhood where the building is constructed. Money from commercial park availability charges can be spent on any park development. Ramsey County – within this C.I.P. document this is used to identify that portion of public works improvement costs that are paid for by Ramsey County. When county roads within the city are improved, the cost of the improvements is jointly financed by the two governments. Redevelopment Fund – accounts for cash assets that are for a redevelopment and housing rehabilitation and replacement program that is designed to eliminate scattered blighted housing, provide new housing, and provide funds for rehabilitation and repair. Sewer Fund – this fund accounts for customer sanitary sewer service charges that are used to finance the sanitary sewer system operating expenses. St. Paul Water – within this C.I.P. document this is used to identify a portion of public works improvement costs that are paid by the St. Paul Regional Water Services. St. Paul Water Availability Charge Fund – thisfund accounts for revenue from water connection charges and a water surcharge that is paid by the owners of property that receive water from St. Paul Regional Water Services. These revenues are used to finance water system costs that cannot be assessed. State Aid – within this C.I.P. document under project funding source on the project detail pages the term State Aid refers to money received from the state for street construction projects. State aid allotments for street construction are based on two factors: population and fiscal need. Fiscal need is determined by the estimated costs of construction and maintenance of the city’s state aid streets over 25 years. Street Light Utility Fund – this fund accounts for revenues established through a franchise agreement with electricity providers to property within the City. A charge is placed on all electric bills and the funds raised from that charge are provided to the City for the use on street light, power system and traffic control systems. Tree Preservation Fund – developers who are unable to comply with city policies on tree preservation may be allowed to deposit funds for furtherance of city tree goals in other parts of the city. Vadnais Heights – within this C.I.P. document this is used to identify a portion of public works improvement costs that are paid by the City of Vadnais Heights. When roads on the border between Maplewood and Vadnais Heights are improved, the two governments jointly finance the cost of the improvement. PacketPageNumber65of194 17 Attachment 1 FIVE - YEAR CAPITAL IMPROVEMENT PLAN BY FUNDING SOURCES TOTAL$65,321,870 PacketPageNumber66of194 18 Attachment 1 GENERAL COMMUNITY DEVELOPMENT INFORMATION Community Growth Population, Households and Household Size 1990 2000 2009* 2010 2020 2030 Occupied Housing Units Household Size (people per household) Population Undeveloped Land Projected Population PacketPageNumber67of194 19 Attachment 1 Streets Commercial Residential Mixed - Use Water PacketPageNumber68of194 20 Attachment 1 MAPLEWOOD POPULATION STATISTICS ESTIMATEDPOPULATIONNEWOCCUPIED YEARPOPULATIONGAINDWELLING UNITSHOUSEHOLD UNITS Sources: Estimated Population New Dwelling Units Occupied Household Units PacketPageNumber69of194 21 Attachment 1 Chart 1 Maplewood Estimated Population 2001 to 2016 Year Maplewood Population Chart 2 2001 to 2016 Year PacketPageNumber70of194 22 Attachment 1 Maplewood Population 2001-2016 ) Year PacketPageNumber71of194 23 Attachment 1 City of Maplewood Population by Neighborhood PacketPageNumber72of194 24 Attachment 1 DEBT CAPACITY AND FINANCING STRATEGY PacketPageNumber73of194 Attachment 1 DEBT CAPACITY During the preparation of this Capital Improvement Plan, the City's present and future debt capacity was evaluated. This was done to determine the amount of additional bonds that could be issued to finance the projects that were requested by departments for the Capital Improvement Plan. The primary emphasis of the debt capacity analysis was to determine the amount of debt that could be issued without causing a downgrading of the City's bond rating. Also, the analysis included a projection of the City's legal debt margin which is the difference between the maximum debt allowed under state law and the amount of debt outstanding. Bond ratings are based on economic, debt, administrative, and fiscal factors. Consequently, ratings are subjective and there is not a formula that can be followed to calculate a bond rating. However, there are two quantitative measures for comparing relative debt burdens: debt per capita and the ratio of debt to tax base. Unfortunately there are not any absolute benchmarks as to what these ratios should be. Until 1998 Moody's Investors Service annually published medians that indicated averages based upon population categories of cities. The analysis of Maplewood's debt capacity included a review of data for the past five years on debt ratios and bond ratings. Also, the analysis included a projection of future debt transactions, population changes, tax base growth, and debt ratios. The amount of debt anticipated to be issued in 2012-2016 is $32,540,000. Most of the bonds planned to be issued between 2012 and 2016 will be for public works improvements. Debt transactions and outstanding debt for 2007-2016 are shown on the next two pages. PacketPageNumber74of194 25 Attachment 1 DEBT TRANSACTIONS PAST FIVE YEARS AND NEXT FIVE YEARS NewLess DebtDebtDebtEscrowNet Debt YearIssuedPaidOutstandingFundsOutstanding 2007Balance Forward69,772,297(2,560,000)67,212,297 200811,040,000(5,460,000)75,352,297(2,560,000)72,792,297 20097,370,000(10,105,000)72,617,297(2,560,000)70,057,297 201015,840,000(9,485,000)78,972,297(4,125,000)74,847,297 201110,000,000(10,955,000)78,017,297078,017,297 20128,563,000(6,825,000)79,755,297079,755,297 20137,912,000(8,182,458)79,484,839079,484,839 20142,451,000(8,559,672)73,376,167073,376,167 20158,546,000(8,375,537)73,546,631073,546,631 20165,068,000(8,466,101)70,148,530070,148,530 PacketPageNumber75of194 26 Attachment 1 C.I.P IMPACT ON CITY DEBTC.I.P IMPACT ON CITY DEBT 2007 TO 2016 -CURRENT AND PROJECTED2007 TO 2016 -CURRENT AND PROJECTED PROJECTEDCURRENT PacketPageNumber76of194 27 Attachment 1 Population projections for the next five years were made in order to project the debt per capita. (Debt per capita is calculated by dividing the outstanding debt by the population.) These projections are explained at the end of Section 1 under the heading General Community Development Information. The following table is a compilation of the preceding projections: PROJECTED DEBT PER CAPITA Debt OutstandingDebt Per Capita WithoutWithWithoutWith NewNewProjectedNewNew YearDebtDebtPopulationDebtDebt 201271,192,29779,755,29737,9001,8782,104 201363,639,83979,484,83937,9501,6772,094 201456,290,16773,376,16738,0001,4811,931 201549,284,63173,546,63138,0501,2951,933 201642,728,53070,148,53038,1001,1211,841 PacketPageNumber77of194 28 Attachment 1 DEBT PER CAPITADEBT PER CAPITA 2007 TO 2016 -CURRENT AND PROJECTED2007 TO 2016 -CURRENT AND PROJECTED PacketPageNumber78of194 29 Attachment 1 Theratioofdebttotaxbasewasalsoanalyzed.Thisratioiscalculatedbydividingthedebt outstandingbytheestimatedfullmarketvalueofMaplewood'staxbase.Theestimatedfull marketvalueoftheCity'staxbasewasprojectedfor2012-2016basedupontheassumption thatitwouldnotchangein2012andincreaseby2%in2013,2%in2014,3%in2015and 3% in 2016. The following table is a compilation of the preceding projections: PROJECTED DEBT TO MARKET VALUE Debt OutstandingDebt To Market Value WithoutWithProjectedWithoutWith NewNewTax BaseNewNew YearDebtDebtMarket ValueDebtDebt 201271,192,29779,755,2973,859,329,0001.8%2.1% 201363,639,83979,484,8393,936,516,0001.6%2.0% 201456,290,16773,376,1674,015,246,0001.4%1.8% 201549,284,63173,546,6314,135,703,0001.2%1.8% 201642,728,53070,148,5304,259,774,0001.0%1.6% PacketPageNumber79of194 30 Attachment 1 RATIO OF DEBT TO MARKET VALUERATIO OF DEBT TO MARKET VALUE 2007 TO 2016 -Current and Projected2007 TO 2016 -Current and Projected PacketPageNumber80of194 31 Attachment 1 City bonds have an “Aa+” rating from Standard and Poor’s Investor Rating Service according to their report dated April 8, 2010. The previous rating was “Aa2” by Moody's Investors Service according to their report dated March 6, 2009. The switch in rating services results in a conversion to compare ratings. A rating of “Aa+” from Standard and Poor’s is comparable to an “Aa1” rating by Moody's which means an increase for the City. The last rating increase from “A-1” to “Aa” in 1989 was due to “continued growth and diversification of the City’s economy, strength and long-term stability of its dominant taxpayer and well maintained finances add to margins of protection for debt which poses a moderate burden.” The increase in the rating was partially due to a globalization by the rating industry to make ratings of government general obligation debt comparable to the ratings of corporate debt of equal risk. In addition, Standard and Poor’s noted continual strength and stability of Maplewood’s dominant tax payers and well maintained finances and investment in infrastructure as overall strength. Only about 8% of Standard and Poor's ratings nationwide are “Aa+” or better. The projected debt ratios indicate that Maplewood will probably be able to maintain its present bond ratings through 2016. Another important factor related to the City’s debt capacity is the State legal debt limit. This limit is 3.0% of the assessor’s market value of the City’s tax base. Bond issues covered by this limit are those that are financed by property taxes unless at least 20% of the annual debt service costs are financed by special assessments or tax increments. Maplewood has three debt issues that are subject to the debt limit in 2012-2016. The difference between the statutory debt limit and the bonds outstanding that are covered by the debt limit is referred to as the legal debt margin. The table below shows Maplewood’s legal debt margin for the years 2012-2016. It indicates that the City is currently and will be significantly under the legal debt limit for the entire period. Projection of Legal Debt Margin December 31 PacketPageNumber81of194 32 Attachment 1 CAPITAL IMPROVEMENT PLAN FINANCING STRATEGY The five-year total for the projects in the C. I. P. is $65,321,870. Funding sources by year for the C.I.P. are as follows: The financial resources available and appropriate for each project are partly determined by its category. General obligation improvement bonds, municipal state aid bonds, special assessment bonds and St. Paul Water Availability Funds will be used for public works projects. Tax increment bonds, Special Assessment Bonds, and the Redevelopment Fund will be used for redevelopment projects. The Ambulance Service Fund can only be used for ambulances. The Environmental Utility Fund can only be used for storm water system improvements. The Fleet Management Fund can only be used for non-public safety vehicles and equipment. The Park Development Fund can only be used for park development projects and the Sanitary Sewer Fund can only be used for sanitary sewer utility system items. General obligation bonds and the Capital Improvement Projects Fund can be used for more than one type of project. General obligation bonds (that are not supported by special assessments) require voter approval and can be generally issued for any public purpose. Tax increment bonds and the tax increment funds can be used for redevelopment, park development and public works improvements provided they are done within a PacketPageNumber82of194 33 Attachment 1 reasonable proximity of the property development that created the increment. There should also be a relationship between the need for the improvement projects and the property development. The 2012-2016 C.I.P. assumes that no bond issue referendums will be held during this five-year period. Bonds totaling $32,540,000 are planned to be issued in 2012-2016 to finance project costs. Under state law, at least 20% of a project’s costs must be assessed in order to issue special assessment and general obligation improvement bonds without a referendum. Projects from 2012-2016 will have 40 - 50% of costs assessed. Several projects and major purchases in the C.I.P. will be financed by the Ambulance Service Fund, Capital Improvement Projects (CIP) Fund, Community Center Operations Fund, Environmental Utility Fund, Fire Truck Replacement Fund, Fleet Management Fund, Information Technology Fund, Park Development Fund, Sanitary Sewer Fund, St. Paul Water Availability Charges (WAC) Fund and the Street Light Utility Fund. Financial resources have been and will be accumulated in these funds for the specified projects. Impact on Property Taxes General obligation improvement bonds are issued to finance public works project costs that are not assessed and not financed by other revenue sources (e.g., state aid, Sanitary Sewer Fund, Ramsey County, or other cities). The annual principal and interest payments on these bonds are financed by property taxes in the debt service portion of the city’s annual budget. These debt service property tax levies were $3,624,702 for 2010 and $3,958,103 for 2011. New general obligation improvement bonds totaling $11,120,000 are anticipated to be issued over the next five years to finance projects. The tax levies required for the principal and interest payments on existing and new bonds are listed in the table below. Property taxes are also levied for several funds to finance other projects in the Capital Improvement Plan. The property tax levies for projects by fund are also listed in the table below. FUNDTOTAL20122013201420152016 DEBT SERVICE: $19,741,691$4,249,711$4,178,905$4,136,118$3,603,361$3,573,596 FOR BONDS ISSUED PRIOR TO 2011 1,381,753276,922276,320274,670276,170277,671 FOR BONDS ISSUED IN 2011 1,823,0000214,000408,000507,000694,000 FOR IMPROVEMENT BONDS ISSUED 2012-2016 DEBT SERVICE TOTAL22,946,4444,526,6334,669,2254,818,7884,386,5314,545,267 CAPITAL IMPROVEMENT PROJECTS1,325,000295,000295,000295,000295,000145,000 FIRE TRUCK REPLACEMENT500,000100,000100,000100,000100,000100,000 TOTAL$24,771,444$4,921,633$5,064,225$5,213,788$4,781,531$4,790,267 The financial resources within the Capital Improvement Projects Fund are derived primarily from property taxes. This fund is used to finance major capital outlay expenditures that cannot be easily financed by alternative methods and that individually cost in excess of $50,000. The tax levies for the Capital Improvement Projects Fund, Fire Truck Replacement Fund and Redevelopment Fund was $0 for 2011. In order to finance the 2012-2016 C.I.P., the tax levy for these three funds will need to total $1,825,000 over the next five years. Overall, the projects included within the 2012-2016 C.I.P. can be financed without depleting the City’s financial resources. Each year when a new C.I.P. is prepared, the financing plans will be reviewed and refined as necessary. PacketPageNumber83of194 34 Attachment 1 PROJECT DETAILS PacketPageNumber84of194 Attachment 1 PROJECT DETAILS The pages in this section consist of a one-page summary for each project and maps showing the location of each project. The projects are grouped by neighborhood beginning with Western Hills-Neighborhood #1 which is in the northwest corner of the city. There are 13 neighborhoods in Maplewood and the location of each is shown on the map on the next page. The 14th part of this section consists of projects without a neighborhood designation. Most of these projects are large equipment purchases which will be used throughout the city. PacketPageNumber85of194 35 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber86of194 36 Attachment 1 PacketPageNumber87of194 37 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Western Hills - Neighborhood #1 No projects are planned for this neighborhood. 2000 – 1,363 Breakdown by density: Fully developed – 1,477 567– Low density 37– medium density 873– Highdensity PacketPageNumber88of194 38 Attachment 1 25 35E 49 30 PacketPageNumber89of194 39 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Parkside - Neighborhood #2 AArkwright/Sunrise Area Streets PW11.090 2000 – 4,658 Breakdown by density: Fully developed – 5,028 3,572– Low density 481– medium density 975– Highdensity PacketPageNumber90of194 40 Attachment 1 /IPPIV 0EOI 3ILVPMRI 0EOI )HKIVXSR 4EVO 6SWIPE[R 4EVO &)00;33(%:)) 4EVOWMHI 2IMKLFSVLSSH PacketPageNumber91of194 41 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber92of194 42 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: Construction: PROJECT COMPLETION DATE: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber93of194 43 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Kohlman Lake - Neighborhood #3 No projects are planned for this neighborhood. 2000 – 1,588 Breakdown by density: Fully developed – 2,490 2,133– Low density 357– medium density 0– Highdensity PacketPageNumber94of194 44 Attachment 1 19 61 /SLPQER 22 +IVZEMW 0EOI 0EOI 23 7TSSR 0EOI PacketPageNumber95of194 45 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Hazelwood - Neighborhood #4 ALegacy Park Improvements PM12.010 2000 – 3,290 Breakdown by density: Fully developed – 3,895 2,538– Low density 228– medium density 1,129– Highdensity PacketPageNumber96of194 46 Attachment 1 65 19 23 23 65 ª 36 PacketPageNumber97of194 47 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber98of194 48 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber99of194 49 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Maplewood Heights - Neighborhood #5 No projects are planned for this neighborhood. 2000 – 2,298 Breakdown by density: Fully developed – 2,929 1,549– Low density 1,300– medium density 80– Highdensity PacketPageNumber100of194 50 Attachment 1 694 ª 120 68 107 19 109 65 PacketPageNumber101of194 51 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Sherwood Glen - Neighborhood #6 A Police Department Expansion MT08.150 BMaplewood Community Center Improvements MT12.010 TH 36 – English Intersection Improvements PW07.100 C 2000 – 3,599 Breakdown by density: Fully developed – 3,767 2,721– Low density 712– medium density 334– Highdensity PacketPageNumber102of194 52 Attachment 1 ª 36 61 25 65 25 PacketPageNumber103of194 53 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber104of194 54 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: Construction: PROJECT COMPLETION DATE: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber105of194 55 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber106of194 56 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber107of194 57 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Gladstone - Neighborhood #7 AGladstone Area Streetscape – Phase I CD04.010 BGladstone – Phase II CD09.020 Gladstone Savanna Improvements PM08.050 C 2000 – 3,235 Breakdown by density: Fully developed – 3,586 3,027– Low density 422– medium density 137– Highdensity PacketPageNumber108of194 58 Attachment 1 28 28 27 65 ;EOIJMIPH 0EOI 29 0EOI 62 30 4LEPIR PacketPageNumber109of194 59 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber110of194 60 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber111of194 61 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber112of194 62 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber113of194 63 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Hillside - Neighborhood #8 AGoodrich Park Improvements PM11.020 2000 – 3,520 Breakdown by density: Fully developed – 5,023 2,257– Low density 2,517– medium density 249– Highdensity PacketPageNumber114of194 64 Attachment 1 29 30 30 68 ª 120 PacketPageNumber115of194 65 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber116of194 66 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber117of194 67 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Beaver Lake - Neighborhood #9 ALions Park Improvements PM03.010 BGethsemane Park PM10.040 City Landfill Closure PW02.120 C DBartelmy/Meyer Area Streets PW08.070 EFarrell/Ferndale Area Street Improvements PW09.080 2000 – 4,888 Breakdown by density: Fully developed – 5,646 2,173– Low density 2,958– medium density 515– Highdensity PacketPageNumber118of194 68 Attachment 1 ª 120 31 &IEZIV 0EOI ª 5 1MGLEIP 0EOI 34 10EOI 68 ª 120 94 PacketPageNumber119of194 69 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber120of194 70 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber121of194 71 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber122of194 72 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber123of194 73 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber124of194 74 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: Construction: PROJECT COMPLETION DATE: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber125of194 75 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Battle Creek - Neighborhood #10 ADennis/McClelland Area Street Improvements PW09.100 2000 – 1,138 Breakdown by density: Fully developed – 1,470 1,270– Low density 0– medium density 200– Highdensity PacketPageNumber126of194 76 Attachment 1 ª %JXSR ,IMKLXW 4EVO &EXXPI'VIIO 2IMKLFSVLSSH PacketPageNumber127of194 77 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber128of194 78 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber129of194 79 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Vista Hills - Neighborhood #11 ACrestview/Highwood Area Streets PW08.060 2000 – 2,519 Breakdown by density: Fully developed – 2,805 1,143– Low density 1,642– medium density 20– Highdensity PacketPageNumber130of194 80 Attachment 1 'VIWXZMI[ 4EVO :MWXE ,MPPW 4EVO :MWXE,MPPW 2IMKLFSVLSSH PacketPageNumber131of194 81 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber132of194 82 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: Construction: PROJECT COMPLETION DATE: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber133of194 83 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Highwood - Neighborhood #12 AFish Creek Open Space PM11.010 BLakewood/Sterling Area Streets PW08.050 2000 – 2,706 Breakdown by density: Fully developed – 3,106 2,906– Low density 200– medium density 0– Highdensity PacketPageNumber134of194 84 Attachment 1 72 25 68 494 43 PacketPageNumber135of194 85 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber136of194 86 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: Construction: PROJECT COMPLETION DATE: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber137of194 87 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects Located in Carver Ridge - Neighborhood #13 A Sterling Street Bridge Replacement PW12.020 2000 – 145 Breakdown by density: Fully developed – 724 724– Low density 0– medium density 0– Highdensity PacketPageNumber138of194 88 Attachment 1 494 72 PacketPageNumber139of194 89 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber140of194 90 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber141of194 91 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 – 2016 Projects without a Neighborhood Designation Replacement of Fire Truck FD03.020 Replacement of Fire Truck FD06.020 Ambulance ReplacementFD08.010 Ambulance ReplacementFD09.020 Replacement of Fire Station FD10.010 Replacement of Fire Station FD10.011 Election EquipmentIT12.010 Public Works CarpetingMT08.130 Nature Center Building Improvements MT12.020 Community Field UpgradesPM07.010 Park Equipment, Fence and Court Replacement PM08.040 Open Space ImprovementsPM08.060 Lift Station Upgrade ProgramPW03.210 Two Toro Lawn Mowers and Two Trailers PW06.010 One Tractor Loader and One 3 Wheel Truckster PW06.060 One Snow Plow Truck PW06.070 1-Ton Truck PW07.030 Two Jacobsen Lawn Mowers PW08.020 Two Toro Mowers and One 4-Wheel Truckster PW09.020 Two 1 Ton Truck and One ½ Ton Truck PW09.030 Jetter Truck PW11.020 Paralleloram LifPW11.030 gt Sinle Axle Plow Truck PW11.040 g Emerenc GeneratoPW11.050 gyr Mill and OverlasPW12.010 y MT-Trackless Maintenance Vehicle PW12.030 Two ½ Ton PickupsPW12.040 One Ton Truck PW12.050 Crack RouterPW12.060 Grounds SweeperPW12.070 PacketPageNumber142of194 92 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber143of194 93 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber144of194 94 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber145of194 95 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber146of194 96 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber147of194 97 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: Construction: PROJECT COMPLETION DATE: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber148of194 98 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber149of194 99 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber150of194 100 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber151of194 101 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber152of194 102 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber153of194 103 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber154of194 104 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber155of194 105 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber156of194 106 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber157of194 107 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber158of194 108 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber159of194 109 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber160of194 110 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber161of194 111 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber162of194 112 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber163of194 113 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber164of194 114 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber165of194 115 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber166of194 116 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber167of194 117 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber168of194 118 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber169of194 119 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber170of194 120 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber171of194 121 Attachment 1 CITY OF MAPLEWOOD CAPITAL IMPROVEMENT PLAN 2012 - 2016 PROJECT TITLE:TOTAL COST: PROJECT NUMBER:PROJECT CATEGORY: DESCRIPTION: JUSTIFICATION: PROJECT COSTS AND FUNDING SOURCES BY YEARS: PROJECT COSTS PROJECT STARTING DATE:Preliminaries: Land Acquisition: PROJECT COMPLETION DATE:Construction: Equipment and Other: NEIGHBORHOOD:Project Costs: PacketPageNumber172of194 122 Attachment 1 APPENDIX PacketPageNumber173of194 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY DEPARTMENT Status: PROJECTTOTAL PRIOR NUMBERCOST PROJECT TITLE20122013201420152016 YEARS 10,100,0004,725,0001,275,0000400,0003,700,0000 7,192,92504,000,000119,8502,458,7250614,350 125,00000125,000000 2,189,400375,000300,000350,000503,400350,000311,000 8,210,4001,460,4002,080,0003,285,000680,000305,000400,000 45,089,5451,025,0004,700,71214,445,3517,694,4939,768,0317,455,958 PacketPageNumber174of194 123 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY DEPARTMENT Status: PROJECTTOTAL PRIOR NUMBERCOST PROJECT TITLE20122013201420152016 YEARS 72,907,2707,585,40012,355,71218,325,20111,736,61814,123,0318,781,308 PacketPageNumber175of194 124 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY FUNDING SOURCE Status: PROJECTTOTAL PRIOR NUMBERCOST PROJECT TITLEFUNDING SOURCE20122013201420152016 YEARS 243,29500119,85000123,445 11,494,900375,0002,783,4002,525,2001,285,6002,423,3002,102,400 6,441,8001,225,0002,104,2001,761,600400,000565,000386,000 15,310,0001,800,0003,051,0002,691,000765,0004,423,0002,580,000 500,00000500,000000 3,609,400270,000300,000325,0002,353,400200,000161,000 1,250,000150,000100,000250,000250,000250,000250,000 PacketPageNumber176of194 125 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY FUNDING SOURCE Status: PROJECTTOTAL PRIOR NUMBERCOST PROJECT TITLEFUNDING SOURCE20122013201420152016 YEARS 4,818,200475,000505,000857,200693,0001,049,0001,239,000 7,200,000004,200,0003,000,00000 949,630000458,7250490,905 1,629,5450395,712300,351314,493313,031305,958 2,875,000175,000250,0001,200,00001,250,0000 5,700,0001,900,000300,0001,500,000900,0001,100,0000 2,965,4001,040,400905,00060,000505,000205,000250,000 PacketPageNumber177of194 126 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY FUNDING SOURCE Status: PROJECTTOTAL PRIOR NUMBERCOST PROJECT TITLEFUNDING SOURCE20122013201420152016 YEARS 525,000175,000175,000175,000000 3,136,4000445,6001,236,200444,600635,000375,000 2,083,8000318,600489,400283,400733,600258,800 949,900097,200134,40083,400376,100258,800 1,225,0000625,00000600,0000 72,907,2707,585,40012,355,71218,325,20111,736,61814,123,0318,781,308 PacketPageNumber178of194 127 Attachment 1 THIS PAGE INTENTIONALLY LEFT BLANK PacketPageNumber179of194 128 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY PROJECT CATEGORY Status: PROJECTPROJECTTOTAL PRIOR NUMBERCATEGORYCOST PROJECT TITLE20122013201420152016 YEARS 8,189,400375,0004,300,000350,0002,503,400350,000311,000 2,947,4700395,712545,201773,218313,031920,308 8,210,4001,460,4002,080,0003,285,000680,000305,000400,000 43,460,0001,025,0004,305,00014,145,0007,380,0009,455,0007,150,000 0 10,100,0004,725,0001,275,0000400,0003,700,000 8,781,308 72,907,2707,585,40012,355,71218,325,20111,736,61814,123,031 PacketPageNumber180of194 129 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY NEIGHBORHOOD Status: PROJECTTOTAL PRIOR PROJECT TITLE NUMBERNEIGHBORHOODCOST 2016 2012201320142015 YEARS 4,480,000200,0004,280,000000 0 75,0000075,00000 0 16,075,0001,100,0008,350,0004,850,000350,000250,000 1,175,000 11,800,0002,375,0000700,0003,700,000300,000 4,725,000 468,00000175,000175,0000 118,000 8,542,4002,855,000775,000200,0003,890,0000 822,400 4,250,00000200,0004,050,0000 0 7,350,000000200,0007,150,000 0 6,435,000425,0002,855,0002,580,00000 575,000 1,315,0000001,315,0000 0 PacketPageNumber181of194 130 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY NEIGHBORHOOD Status: PROJECTTOTAL PRIOR PROJECT TITLE NUMBERNEIGHBORHOODCOST 2016 2012201320142015 YEARS 12,116,8705,400,7122,065,2012,956,618443,0311,081,308 170,000 72,907,2707,585,40012,355,71218,325,20111,736,61814,123,0318,781,308 PacketPageNumber182of194 131 Attachment 1 FIVE-YEAR CAPITAL IMPROVEMENT PLAN PROJECTS GROUPED BY DEPARTMENT Status: PROJECTTOTAL PRIOR NUMBERCOST PROJECT TITLE20122013201420152016 YEARS 12,400,0000350,000350,000350,000350,00011,000,000 5,127,15503,550,000150,000300,00001,127,155 10,571,7000020,00058,00020,00010,473,700 815,000410,000165,000185,00035,00020,0000 28,913,855410,0004,065,000705,000743,000390,00022,600,855 PacketPageNumber183of194 132 Attachment 1 PROJECTS DEFERRED/DECLINED In the course of preparation of this Capital Improvement Plan, several noteworthy projects were proposed but deemed by staff to not be appropriate for inclusion at this time. These projects are discussed below and included for your review. Hillcrest Area Redevelopment – Staff recommends that this project be deferred until the Gladstone Neighborhood Redevelopment is further along so as to avoid competing with each other. Housing Replacement Program – This is a worthwhile project and the current economic conditions would call for some investment in this project. City finances are not currently available to provide sufficient benefit. Commercial Property Redevelopment – While this is a worthy project, staff does not believe that the costs are a priority use of tax levies. Staff will continue to look for opportunities in this area. Joy Park Improvements – Staff recommends deferral pending accumulation of Park Availability Charges. Police Department Expansion – This is an expensive proposition and its need has not been adequately demonstrated. Space needs at City Hall continue to be evaluated. This project may require a referendum to identify a source of funds. Replacement/rehabilitation of Fire Station – This item was deferred due to the high cost and a lack of funding identified. The Fire Chief will continue to monitor the station situation. Fire Training Facility – This is a very costly project and requires funding from other agencies. The project needs to be deferred until the funding can be acquired. City Hall Carpeting – The carpet is showing wear. Staff believes this need needs to be deferred for a few more years due to the lack of funding. City Campus Improvements – While staff recognizes that improvements need to be made, other project demands on the CIP fund are more critical. City Facilities Security System Enhancements – This proposal would add security cameras and card reader access along with enhanced monitoring capabilities to the city campus and fire stations.Staff believes other project demands on the CIP fund are more critical. Public Works Emergency Generator Replacement – Staff believes other project demands on the CIP fund are more critical. Ambulance Replacement – The replacement rates for the ambulance fleet has been delayed by one year at the recommendation of the Fire Chief based upon current department needs. Various Street Improvements – The following street improvement projects are deferred to 2017 or beyond and will be considered in the normal street improvement plan due to limited funding and a desire to reduce the level of City debt: Hillcrest Area Roadway Improvements o Hillcrest Area Streetscape o Gladstone – Phase III o PacketPageNumber184of194 133 Attachment 1 CITY OF MAPLEWOOD, MINNESOTA AMBULANCE SERVICE FUND (606) PacketPageNumber185of194 134 Attachment 1 CAPITAL IMPROVEMENT PROJECTS FUND (405) PacketPageNumber186of194 135 Attachment 1 COMMUNITY CENTER OPERATIONS FUND (602) PacketPageNumber187of194 136 Attachment 1 ENVIRONMENTAL UTILITY FUND (604) PacketPageNumber188of194 137 Attachment 1 FIRE TRUCK REPLACEMENT FUND (424) PacketPageNumber189of194 138 Attachment 1 FLEET MANAGEMENT FUND (702) PacketPageNumber190of194 139 Attachment 1 PARK DEVELOPMENT FUND (403 ) PacketPageNumber191of194 140 Attachment 1 SANITARY SEWER FUND (601) PacketPageNumber192of194 141 Attachment 1 STREET LIGHT UTILITY FUND (607) PacketPageNumber193of194 142 Attachment 1 WATER AVAILABILITY CHARGE FUND -- ST. PAUL WATER DISTRICT (40 7 PacketPageNumber194of194 143